DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and Tex13c

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001182199.1 Gene:Tex13c / 298164 RGDID:1563975 Length:608 Species:Rattus norvegicus


Alignment Length:407 Identity:70/407 - (17%)
Similarity:124/407 - (30%) Gaps:135/407 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LGFNFAPAPIP-------QASAA-----------SGLSPRGMYSDLYRYEDGSGDASGSLLLVQE 96
            ||..:: .|:|       .|:||           ||:.|.|::..|     ||.:.     :...
  Rat   226 LGVPYS-TPVPCSVLMDTGATAAAMATALPHIPPSGIYPAGLWVTL-----GSQET-----IAPT 279

  Fly    97 DDHFCGAEAD-----QQL------VASTSSSCPMASSGESVSIDTEQEA--ERDLQMNQCETLER 148
            .|..|..|.:     |.|      |:.:....|..|.|.|:..|:.:.:  |.|.:.......|:
  Rat   280 WDQICHRENECSEILQDLSHLTDNVSHSEEEGPEKSQGTSLHRDSSKNSHKENDAKPRMMAATEK 344

  Fly   149 EELNGDIGEMGEMEELAEEVNGE---QRPPLLP----------------CMG------------- 181
            :.|      :...:..|.|||..   :...::|                |:|             
  Rat   345 KNL------VIHQKTPAVEVNSNPSTKEESVMPQGIAAQGKKSSSTQKKCLGTSQKVADSKESIC 403

  Fly   182 -GNTSYMVFPRTAADYMPRLALPR----------------------------HRPYISIGQEQYV 217
             .|.|..|......|.......|.                            |:...::|:....
  Rat   404 HNNKSVSVTISKETDTSGNKTTPSLKKYPGILLRKPDLGNKVSCNKKDDTKIHQRVANLGEGIRN 468

  Fly   218 IQAETVF--VLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSP 280
            :|.|..|  :.|:....:.|:........|.||......:|      ||:.....|:.. :|.:.
  Rat   469 VQKEDTFQQMTGLATGGSPNEKKTQTVPQGTIKSQSQKEEP------NKVQANHPGKCK-SYFTN 526

  Fly   281 FSAQAAISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKWKPAIDNWVC 345
            ...:..::.....| ..|.|..|.:           ..|:...:.|.::.::.:..:.:: |.||
  Rat   527 KGPKTQLAPKQKVK-PPQEIKALES-----------KQPQGTKSSESKQHEKPLSHRTSV-NSVC 578

  Fly   346 MLCRNSNFVWRSSCNRC 362
            ..|:..|    .||..|
  Rat   579 SSCKAVN----RSCKGC 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 17/114 (15%)
RRM_SF 223..302 CDD:302621 14/80 (18%)
zf-RanBP 343..366 CDD:279035 7/20 (35%)
RanBP2-type Zn finger 343..362 CDD:275375 6/18 (33%)
zf-RanBP 397..423 CDD:295417
RanBP2-type Zn finger 398..417 CDD:275375
Tex13cNP_001182199.1 TEX13 5..148 CDD:291842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.