DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and Taf15

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001099294.2 Gene:Taf15 / 287571 RGDID:1309595 Length:572 Species:Rattus norvegicus


Alignment Length:465 Identity:111/465 - (23%)
Similarity:158/465 - (33%) Gaps:146/465 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NYSD--TQQPQPQLQTQQQMFHANYIVGTTLGSGLGFNFAPAPIPQASAASGLSPRGMYSDLYRY 80
            :||.  .|..|...||||.  ::.|  |.|..|..|.|:                 |.||...:.
  Rat    16 SYSSYGNQGSQGYGQTQQS--YSGY--GQTTDSSYGQNY-----------------GGYSGYGQN 59

  Fly    81 EDGSGDASGSLLLVQEDDHFCGAEA----DQQLVASTSSSCPMASS------GESVSID-----T 130
            :.|...:.||....::..:  |.::    .||...|:......|.|      |:..|.|     .
  Rat    60 QSGYSQSYGSYENQKQSSY--GQQSYNNQGQQNTESSGGQGGRAPSYGQSDYGQQDSYDQQSGYD 122

  Fly   131 EQEAERDLQMN-----------QCETLEREELN----GDIGEMGEMEELAEEVNGEQ-------- 172
            :.:...|.|.|           |....:||..:    .|..:|....|......|.|        
  Rat   123 QHQGSYDEQSNYQQHDSYNQNQQSYHPQRENYSHHTQDDRRDMSRYGEDNRGYGGSQGGGRGRGG 187

  Fly   173 -----RPPLLPCMGGNTSYMVFPRTAADYMPRLALPRHRPYISIGQEQYVIQAETVFVLGMRLNV 232
                 |.|:....||:...........||.|       ||  ....|.......|:||.|:...|
  Rat   188 YDKDGRGPMTGSSGGDRGGFKNFGGHRDYGP-------RP--DADSESDNSDNNTIFVQGLGEGV 243

  Fly   233 TKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSAQAAISCLSGAKFMG 297
            :.:.:..||.::|:||.::.|.||.|.:|.:|.||:.|||||:::..|.||:|||....|.:|.|
  Rat   244 STDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHG 308

  Fly   298 QVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKWKPAIDNWVCMLCRNSNFVWRSSCNRC 362
            .:|.|   ..:|||             ||..|                                 
  Rat   309 NIIKV---SFATRR-------------PEFMR--------------------------------- 324

  Fly   363 QADKVVAPQNNEGSSWAGSREEDG-------APRRWRPYRNDWLC--KICYNMNFWYRAKCNRCH 418
                       .|.|..|.|...|       ..|...|...||:|  ..|.||||..|..||:|:
  Rat   325 -----------GGGSGGGRRGRGGYRGRGGFQGRGGDPKNGDWVCPNPSCGNMNFARRNSCNQCN 378

  Fly   419 ALRSDEMKSS 428
            ..|.::.:.|
  Rat   379 EPRPEDSRPS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 40/112 (36%)
RRM_SF 223..302 CDD:302621 32/78 (41%)
zf-RanBP 343..366 CDD:279035 0/22 (0%)
RanBP2-type Zn finger 343..362 CDD:275375 0/18 (0%)
zf-RanBP 397..423 CDD:295417 13/27 (48%)
RanBP2-type Zn finger 398..417 CDD:275375 10/20 (50%)
Taf15NP_001099294.2 PTZ00110 4..>69 CDD:240273 18/73 (25%)
ser_rich_anae_1 <21..>158 CDD:411418 33/159 (21%)
RRM_FUS_TAF15 230..315 CDD:409951 34/87 (39%)
zf-RanBP 352..382 CDD:395516 12/29 (41%)
RanBP2-type Zn finger 356..377 CDD:275376 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539664at2759
OrthoFinder 1 1.000 - - FOG0002238
OrthoInspector 1 1.000 - - otm46254
orthoMCL 1 0.900 - - OOG6_114797
Panther 1 1.100 - - O PTHR23238
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.