DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and FUS

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_004951.1 Gene:FUS / 2521 HGNCID:4010 Length:526 Species:Homo sapiens


Alignment Length:436 Identity:116/436 - (26%)
Similarity:154/436 - (35%) Gaps:126/436 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSASVVYTNSFYAPNY------SDTQQP----QPQLQTQQQMFHA----------NYIVGTTLG 47
            |||.|  |.:|..:.:|      |.:|||    |.|...|||.::.          |...|...|
Human   108 STSGS--YGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGG 170

  Fly    48 SGLGFNFAPAPIPQASAASGLSPRGMYSDLYRYEDGSGDASGSLLLVQEDDHFCGAEADQQLVAS 112
            .|.|.|:..   .|:|.:||....|.|.:    :|.|| ..||....|:|....|..........
Human   171 GGGGGNYGQ---DQSSMSSGGGSGGGYGN----QDQSG-GGGSGGYGQQDRGGRGRGGSGGGGGG 227

  Fly   113 TSSSCPMASSGESVSIDTEQEAERDLQMNQCETLEREELNGDIGEMGEMEELAEEVNGEQRPPLL 177
            .......:|.|                      .|.....|..|..|.|       .|..|    
Human   228 GGGGYNRSSGG----------------------YEPRGRGGGRGGRGGM-------GGSDR---- 259

  Fly   178 PCMGGNTSYMVFPRTAADYMPRLALPRHRPYISIGQEQYVIQAETVFVLGMRLNVTKNDIILFFG 242
               ||      |.:...   ||....||      ..||......|:||.|:..|||...:..:|.
Human   260 ---GG------FNKFGG---PRDQGSRH------DSEQDNSDNNTIFVQGLGENVTIESVADYFK 306

  Fly   243 KVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSAQAAISCLSGAKFMGQVITVLPAYL 307
            ::|:||.::.|.:|.|.:|.::.||:.|||||:::..|.||:|||....|.:|.|..|.|   ..
Human   307 QIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKV---SF 368

  Fly   308 STRR-------------------------------GSVRYSYPRELNAPEHQRRQRAMKWKPAID 341
            :|||                               |..|..:|........|  |||..||    
Human   369 ATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ--QRAGDWK---- 427

  Fly   342 NWVC--MLCRNSNFVWRSSCNRCQADKVVAPQNNEGSSWAGSREED 385
               |  ..|.|.||.||:.||:|:|.|...|....|.|..|....|
Human   428 ---CPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 43/143 (30%)
RRM_SF 223..302 CDD:302621 31/78 (40%)
zf-RanBP 343..366 CDD:279035 11/24 (46%)
RanBP2-type Zn finger 343..362 CDD:275375 9/20 (45%)
zf-RanBP 397..423 CDD:295417
RanBP2-type Zn finger 398..417 CDD:275375
FUSNP_004951.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..286 54/238 (23%)
RRM_FUS_TAF15 283..368 CDD:240979 33/87 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 375..424 6/50 (12%)
zf-RanBP 422..449 CDD:279035 14/33 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..526 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539664at2759
OrthoFinder 1 1.000 - - FOG0002238
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23238
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.