DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and cus-2

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_490765.1 Gene:cus-2 / 171656 WormBaseID:WBGene00022025 Length:442 Species:Caenorhabditis elegans


Alignment Length:213 Identity:50/213 - (23%)
Similarity:83/213 - (38%) Gaps:51/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 QAETVFVLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSA 283
            :...|:|..:..::|..:...|..|.|||:.|..|||||..:|:.: .|:.||:....|:...|.
 Worm   177 KVHAVYVSNLPEDITDEEFQKFMSKCGVIQPDIRTNKPKCKLYREE-NGKLKGDGRCCYIKKESV 240

  Fly   284 QAAISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKWKPAIDNWVCMLC 348
            :.|.:.|.||...|:.:.|..|         |:....:.:....:|:..|.:.|..::.      
 Worm   241 ELACNILDGANLNGREVKVEEA---------RFEMKGDFDPARKRRKLTAAQKKRYMEQ------ 290

  Fly   349 RNSNFVWRSSCNRCQADKVVAPQNNEGSSWAGSREEDGAPRRWRPYRNDWLCKICYNMNFWYRAK 413
            :|..|.|       ..||                     ||.:|| ::|  |.:... |.:.:..
 Worm   291 QNKIFEW-------TPDK---------------------PRNYRP-KSD--CTVIVK-NLFTQEM 323

  Fly   414 CNRCHALRSD---EMKSS 428
            .|:..||..|   ||..|
 Worm   324 MNKNAALMLDLKEEMTQS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 30/112 (27%)
RRM_SF 223..302 CDD:302621 25/78 (32%)
zf-RanBP 343..366 CDD:279035 3/22 (14%)
RanBP2-type Zn finger 343..362 CDD:275375 3/18 (17%)
zf-RanBP 397..423 CDD:295417 6/25 (24%)
RanBP2-type Zn finger 398..417 CDD:275375 3/18 (17%)
cus-2NP_490765.1 RRS1 <93..142 CDD:295203
RRM1_TatSF1_like 179..268 CDD:240727 28/98 (29%)
RRM2_TatSF1_like 310..400 CDD:240728 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.