Sequence 1: | NP_650107.1 | Gene: | CG14718 / 41413 | FlyBaseID: | FBgn0037939 | Length: | 446 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_490765.1 | Gene: | cus-2 / 171656 | WormBaseID: | WBGene00022025 | Length: | 442 | Species: | Caenorhabditis elegans |
Alignment Length: | 213 | Identity: | 50/213 - (23%) |
---|---|---|---|
Similarity: | 83/213 - (38%) | Gaps: | 51/213 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 219 QAETVFVLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSA 283
Fly 284 QAAISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQRRQRAMKWKPAIDNWVCMLC 348
Fly 349 RNSNFVWRSSCNRCQADKVVAPQNNEGSSWAGSREEDGAPRRWRPYRNDWLCKICYNMNFWYRAK 413
Fly 414 CNRCHALRSD---EMKSS 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14718 | NP_650107.1 | RRM | <222..>335 | CDD:223796 | 30/112 (27%) |
RRM_SF | 223..302 | CDD:302621 | 25/78 (32%) | ||
zf-RanBP | 343..366 | CDD:279035 | 3/22 (14%) | ||
RanBP2-type Zn finger | 343..362 | CDD:275375 | 3/18 (17%) | ||
zf-RanBP | 397..423 | CDD:295417 | 6/25 (24%) | ||
RanBP2-type Zn finger | 398..417 | CDD:275375 | 3/18 (17%) | ||
cus-2 | NP_490765.1 | RRS1 | <93..142 | CDD:295203 | |
RRM1_TatSF1_like | 179..268 | CDD:240727 | 28/98 (29%) | ||
RRM2_TatSF1_like | 310..400 | CDD:240728 | 10/35 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |