DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14718 and LOC110438494

DIOPT Version :9

Sequence 1:NP_650107.1 Gene:CG14718 / 41413 FlyBaseID:FBgn0037939 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_021326692.1 Gene:LOC110438494 / 110438494 -ID:- Length:312 Species:Danio rerio


Alignment Length:174 Identity:49/174 - (28%)
Similarity:76/174 - (43%) Gaps:30/174 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 TVFVLGMRLNVTKNDIILFFGKVGVIKMDESTNKPKIFVYKNKITGRSKGEATITYVSPFSAQAA 286
            |:::.|:..|.|..::..||...|.|:::...|:|.|.:|.:|.:|:.||:||::|..|..|:.|
Zfish    46 TIYITGLTENATLPEMAEFFKHTGAIRINRRLNQPAINIYTDKDSGKPKGDATLSYEEPAFAKPA 110

  Fly   287 ISCLSGAKFMGQVITVLPAYLSTRRGSVRYSYPRELNAPEHQR------------------RQRA 333
            :....|.:|.|:.:.|..|......|.:|...|.. ..|...|                  .:..
Zfish   111 VEHFDGKEFQGRRLKVSMARRKPMIGGMRGGMPMR-GGPGMDRGGMMGRGGERGGFPPRGGPRGG 174

  Fly   334 MKWK--PAIDN-------WVC--MLCRNSNFVWRSSCNRCQADK 366
            |.|.  |...|       |.|  :.|.|.||.||..||:|:|.|
Zfish   175 MGWNGGPQPGNVQKRAGDWECPNVGCGNQNFSWRMECNQCKAPK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14718NP_650107.1 RRM <222..>335 CDD:223796 32/130 (25%)
RRM_SF 223..302 CDD:302621 24/78 (31%)
zf-RanBP 343..366 CDD:279035 12/24 (50%)
RanBP2-type Zn finger 343..362 CDD:275375 10/20 (50%)
zf-RanBP 397..423 CDD:295417
RanBP2-type Zn finger 398..417 CDD:275375
LOC110438494XP_021326692.1 RRM_SF 45..128 CDD:327398 26/81 (32%)
zf-RanBP 189..219 CDD:279035 13/30 (43%)
RanBP2-type Zn finger 193..214 CDD:275375 10/20 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539664at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.