DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14718 and TEX13C

DIOPT Version :9

Sequence 1:	NP_650107.1	Gene:	CG14718 / 41413	FlyBaseID:	FBgn0037939	Length:	446	Species:	Drosophila melanogaster
Sequence 2:	NP_001182201.1	Gene:	TEX13C / 100129520	HGNCID:	52277	Length:	993	Species:	Homo sapiens

Alignment Length:	55	Identity:	17/55 - (30%)
Similarity:	26/55 - (47%)	Gaps:	9/55 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   326 EHQRRQRA---MKWKPAI----DNWVCMLCRNSNFVWRSSCNRCQADKVVAPQNN 373
            :.|:|::|   .:.|||.    .||.|..|...||.....|::|:  :|..|..|
Human   935 KEQKRKKASESQQQKPASCSSPVNWACPWCNAMNFPRNKVCSKCK--RVRMPVEN 987

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14718	NP_650107.1	RRM	<222..>335	CDD:223796	3/11 (27%)
		RRM_SF	223..302	CDD:302621
		zf-RanBP	343..366	CDD:279035	7/22 (32%)
		RanBP2-type Zn finger	343..362	CDD:275375	6/18 (33%)
		zf-RanBP	397..423	CDD:295417
		RanBP2-type Zn finger	398..417	CDD:275375
TEX13C	NP_001182201.1	TEX13	5..148	CDD:291842
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	281..381
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	520..547
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	894..959		6/23 (26%)
		ZnF_RBZ	959..979	CDD:197784	6/19 (32%)
		RanBP2-type Zn finger	959..978	CDD:275376	6/18 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165152378
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930