DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and EAT1

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_011529.1 Gene:EAT1 / 852898 SGDID:S000003247 Length:328 Species:Saccharomyces cerevisiae


Alignment Length:296 Identity:61/296 - (20%)
Similarity:119/296 - (40%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QAPPIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLSPYITGHSPMHLAAD-VEALMS 107
            |.|.|:.:|.|..|...:..:...||:.....:.:||.||||:||....:....|..| :..:.:
Yeast    37 QRPAIINIHGLLGSHVMFHSLNKLLSRKLDADIFSVDVRNHGISPKAIPYDYTTLTNDLIYFIET 101

  Fly   108 HQRLNK-IVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVPSNFYLTRQVFEMMLQVAPSI 171
            |..|.: |..||..|||:..:...|.:...:.:.|.:|:.|...|....:..|.:::::::   |
Yeast   102 HIGLERPIYLLGFSMGGKIALLTTLYKNINIRKCISIDLPPYETPELDPMILQNYDLIMRI---I 163

  Fly   172 PSNLSLSEG----RTFILPLFQDV--------------------------VHDASELRRIIYNLR 206
            ..::.:..|    :..:|.||:.:                          ||.|.      .:..
Yeast   164 RRDVKILRGSPSWQKKVLELFKSLECNKRKCGGAVALYFANGFLSVKSNNVHQAQ------LHYE 222

  Fly   207 KMQDNTFGWAVNPQAVLSSWGEMM--INYEATLGGLRPYM------GEVLLIAGSQSEFVTTTSI 263
            :.|.:.:   :|....|||...::  :.....|...|.:.      .:||.:.|.||.|: ....
Yeast   223 QQQHDPY---INYSMPLSSMPNLLDEVKKWPDLSNQRDFFQKGTASRKVLFMKGLQSNFI-NNDY 283

  Fly   264 AVMQRYFPNTVVQILDAGHCVYEDQPEQFVELVVEF 299
            ::::..||...|:..:.||.:..:.||...:.::.|
Yeast   284 SLLRYNFPCADVREFNTGHNLLLENPEDSFKCILNF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 60/294 (20%)
Abhydrolase_5 47..>165 CDD:289465 30/119 (25%)
Abhydrolase <249..301 CDD:304388 12/51 (24%)
EAT1NP_011529.1 Abhydrolase_1 39..309 CDD:395444 57/282 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2382
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62887
OrthoFinder 1 1.000 - - FOG0001908
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.