DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and ECM18

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_010410.3 Gene:ECM18 / 851703 SGDID:S000002532 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:60/340 - (17%)
Similarity:108/340 - (31%) Gaps:109/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLS--PYITGHSPMHLAADVEALMSHQ 109
            |.:::|....|..|:.:....||: .:|.:.::|....|||  |.:..::...|..|::.:..::
Yeast   128 PTLLIHGYAASSMSFFRNYPGLSK-HIRNLYSIDMPASGLSSVPSLEINTTTPLPLDIKFIGENK 191

  Fly   110 ----------------------------------RLNKIVALGHGMGGRAMMTLALTQPQLVERV 140
                                              :|.|:..:||..||......|:..|..|.::
Yeast   192 FKVPYTINANHNKFVIQMYEDFYLDRIEQWRIDNKLGKMNVVGHSFGGYLSFKYAVKYPNSVNKL 256

  Fly   141 ILVDITPAPVPSNFYLTRQVF--EMMLQVAPSIPSNLSLSEGRTFILPLFQDVVHDASELRRIIY 203
            .||  :|..|..|.:.....|  ..:..:....|::...|:.......||:...|          
Yeast   257 CLV--SPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYSKRNMIPKYLFEQQFH---------- 309

  Fly   204 NLRKMQDNTFGWAVNPQAVLSSWGEMMINYEAT---------------LGGL------------- 240
            .||.|         .|......|..:|..|...               .||:             
Yeast   310 ILRMM---------GPLGAKLCWNYIMAAYSRVPSLAYKEYIFELFYGKGGIPEVTTDIFKALFS 365

  Fly   241 ------RPYMGEV-------LLIAGSQSEFVTTTSIAVMQRYFPN--------TVVQILDAGHCV 284
                  .|.|..:       |||...|.:::...:...|.:...|        :.::|..:||.:
Yeast   366 RCILAKDPLMDSLQYLNVKKLLIVYGQYDWMNKKAGMFMVKELNNLKNCLEGASYLEIPSSGHNL 430

  Fly   285 YEDQPEQFVELVVEF 299
            :.|.||.|.:.:|.|
Yeast   431 FLDNPESFNQSIVSF 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 59/338 (17%)
Abhydrolase_5 47..>165 CDD:289465 29/155 (19%)
Abhydrolase <249..301 CDD:304388 14/59 (24%)
ECM18NP_010410.3 PLN02894 <112..442 CDD:215484 58/335 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.