DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and ICT1

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_013200.1 Gene:ICT1 / 850788 SGDID:S000004089 Length:394 Species:Saccharomyces cerevisiae


Alignment Length:342 Identity:70/342 - (20%)
Similarity:120/342 - (35%) Gaps:111/342 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLS--PYITGHSP--------MHLAAD 101
            |.|::|....|..::.:...|||. .::.:..:|...:|.|  |.:..:..        .|:..|
Yeast    72 PTVLIHGYAASSMAFYRTFENLSD-NIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKHIEDD 135

  Fly   102 V-----------EALMSH------------------QRLNKIVALGHGMGGRAMMTLALTQPQLV 137
            |           |.:.||                  .:|.||..:||..||......||..|..:
Yeast   136 VVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKLRKINVVGHSFGGYISFKYALKYPDSI 200

  Fly   138 ERVILVDITPAPV-----------------------PSNFYLTRQ------VFEMMLQVAP---S 170
            |::.|  |:|..|                       ||:.|.||:      :||..|.|..   .
Yeast   201 EKLCL--ISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVPRFIFENQLNVLKWMGP 263

  Fly   171 IPSNLSLSEGRTFILPLFQDVVHDASELRRIIYNLRKM--QDNTFGWAVNPQAVLSSWGEMMIN- 232
            |.|.|..:...|..:.:...:..|        |.|...  ::.|    |.||.:     ::..: 
Yeast   264 IGSKLCSNYISTAYVKVPDQIYKD--------YLLHSFVGKNQT----VQPQTI-----KVFTHL 311

  Fly   233 YEATLGGLRPYMGE---------VLLIAGSQ------SEFVTTTSIAVMQRYFPNTVVQILDAGH 282
            :|..|....|.:..         |:.:.|..      :.::||.|  :::.....:.|::.||||
Yeast   312 FERNLIARDPIINNVRFLNPATPVMFMYGEHDWMDKYAGYLTTES--MLKNKAKASYVEVPDAGH 374

  Fly   283 CVYEDQPEQFVELVVEF 299
            .::.|.|:.|...:|.|
Yeast   375 NLFLDNPQHFASSLVSF 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 69/340 (20%)
Abhydrolase_5 47..>165 CDD:289465 39/185 (21%)
Abhydrolase <249..301 CDD:304388 14/57 (25%)
ICT1NP_013200.1 PLN02894 <53..388 CDD:215484 68/337 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.