DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and AT1G80280

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_178144.1 Gene:AT1G80280 / 844368 AraportID:AT1G80280 Length:647 Species:Arabidopsis thaliana


Alignment Length:284 Identity:69/284 - (24%)
Similarity:123/284 - (43%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IVVMHDLNLSLESWRQVAVNLS-QVGLRQVITV-DARNHGLS--PYITG------HSPMHLAADV 102
            :|::|.....:.|||.|..:|: |:|.  |:|. |....||:  |:...      .:|..|...|
plant   374 VVLVHGFGGGVFSWRHVMSSLAHQLGC--VVTAFDRPGWGLTARPHKKDLEEREMPNPYTLDNQV 436

  Fly   103 EALMS--HQR-LNKIVALGHGMGG-----RAMMTLALTQPQLVERVILVDITPAPVPSNFYLTRQ 159
            :.|::  |:. ...:|.:||..||     .|...|....|..|:.|:|::::         |||:
plant   437 DMLLAFCHEMGFASVVLVGHDDGGLLALKAAQRLLETKDPIKVKGVVLLNVS---------LTRE 492

  Fly   160 VFEMMLQVAPSIPSNLSLSEGRTFIL-PLFQDVV---------HDASELRRIIYNLRKMQDNTFG 214
            |.....::.      |..|.|:..:: ||.:..:         :|.:::...:..|.|...:..|
plant   493 VVPAFARIL------LHTSLGKKHLVRPLLRTEIAQVVNRRAWYDPAKMTTDVLRLYKAPLHVEG 551

  Fly   215 W--AVNPQAVLSSWGEMMINYEATLGGLRPYMG-EVLLIAGSQSEFVTTTSIAVMQRYFPNT-VV 275
            |  |::....|||  ||::..:..|..|:.... .||::||::...|...|..||.....|: :|
plant   552 WDEALHEIGRLSS--EMVLPTQNALSLLKAVENLPVLVVAGAEDALVPLKSSQVMASKLENSRLV 614

  Fly   276 QILDAGHCVYEDQPEQFVELVVEF 299
            .|...||..:|:.|:..:..:..|
plant   615 AISGCGHLPHEECPKALLAAMCPF 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 68/282 (24%)
Abhydrolase_5 47..>165 CDD:289465 35/134 (26%)
Abhydrolase <249..301 CDD:304388 14/52 (27%)
AT1G80280NP_178144.1 MhpC 374..642 CDD:223669 69/284 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I2485
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.