DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and ABHD11

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_024302717.1 Gene:ABHD11 / 83451 HGNCID:16407 Length:434 Species:Homo sapiens


Alignment Length:244 Identity:75/244 - (30%)
Similarity:115/244 - (47%) Gaps:21/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SLESWRQVAVNLSQVGLRQVITVDARNHGLSPYITGHSPMHLAADVEALMSHQRLNKIVALGHGM 121
            ||..|            .||:||||||||.||:....|...::.|::.|:....|...|.:||.|
Human   209 SLAEW------------PQVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGHSM 261

  Fly   122 GGRAMMTLALTQPQLVERVILVDITPAPVPSNFYLTRQVFEMMLQVAPSIPSNLSLSEGRTFILP 186
            ||:..|.|||.:|:||||:|.|||:|.......:....|..|.   |.:|...|..|..|.....
Human   262 GGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMR---AINIADELPRSRARKLADE 323

  Fly   187 LFQDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAVLSSWGEMMINYEATLGGLRPYMGEVLLIA 251
            ....|:.|.:..:.::.||.:: |..|.|.||..|:.....:::    |.......|:|..|.:.
Human   324 QLSSVIQDMAVRQHLLTNLVEV-DGRFVWRVNLDALTQHLDKIL----AFPQRQESYLGPTLFLL 383

  Fly   252 GSQSEFVTTTSIAVMQRYFPNTVVQ-ILDAGHCVYEDQPEQFVELVVEF 299
            |..|:||..:....:.|.||...:| :.:|||.::.|:|:.|:..:..|
Human   384 GGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGF 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 74/242 (31%)
Abhydrolase_5 47..>165 CDD:289465 41/107 (38%)
Abhydrolase <249..301 CDD:304388 15/52 (29%)
ABHD11XP_024302717.1 Atrophin-1 <15..159 CDD:331285
PRK10673 216..433 CDD:331147 71/225 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2382
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62887
OrthoDB 1 1.010 - - D1268438at2759
OrthoFinder 1 1.000 - - FOG0001908
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.