DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and AT5G38360

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001318695.1 Gene:AT5G38360 / 833818 AraportID:AT5G38360 Length:337 Species:Arabidopsis thaliana


Alignment Length:286 Identity:52/286 - (18%)
Similarity:109/286 - (38%) Gaps:76/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSKGGAQVLRNFQSFVQGTRLEYVSYTSPRNQMQAPPIVVMHDLNLSLESWRQVAVN----LSQV 71
            |.||..::|....|   |.::|.:.....:::.:.||:|.:|....:...|   |.|    .|..
plant    35 LKKGQTRLLHKLPS---GLKMEVIEQRKSKSERENPPLVFVHGSYHAAWCW---AENWLPFFSSS 93

  Fly    72 GL-RQVITVDARNHGLSPY--ITGHSPMHLAADVEALMSHQRLNKIVALGHGMGG---------- 123
            |. ...:::..:.....|.  :.|....|.:...:.:.|:...:..|.:||..||          
plant    94 GFDSYAVSLLGQGESDEPLGTVAGTLQTHASDIADFIESNLGSSPPVLVGHSFGGLIVQYYLANI 158

  Fly   124 ---RAMMTLALTQPQLVERVILVDITP---APVPSNFYLTRQV--FEMMLQVA-----PSIPSNL 175
               |::.| ....|:|...|::..:.|   :.:...:..::.|  |::.|.:|     .|||   
plant   159 VNKRSLGT-ENAFPELSGAVMVCSVPPSGNSGLVLRYLFSKPVAAFKVTLSLAAKGFQKSIP--- 219

  Fly   176 SLSEGRTF-------ILPLFQDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAVLSSWGEMMINY 233
             |.....|       ::..:||::.::|.:.  :::|||:                         
plant   220 -LCRETFFSQAMDDQLVKRYQDLMSESSRIP--LFDLRKL------------------------- 256

  Fly   234 EATLGGLRPYMGEV-LLIAGSQSEFV 258
            .|:|...:|..... :|:.|::.:|:
plant   257 NASLPVPKPMENSTKVLVLGAKDDFI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 47/269 (17%)
Abhydrolase_5 47..>165 CDD:289465 25/142 (18%)
Abhydrolase <249..301 CDD:304388 3/10 (30%)
AT5G38360NP_001318695.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1268438at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42886
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.