DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and EPHX3

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001136358.1 Gene:EPHX3 / 79852 HGNCID:23760 Length:360 Species:Homo sapiens


Alignment Length:314 Identity:72/314 - (22%)
Similarity:120/314 - (38%) Gaps:63/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NFQSFVQGTRLEYVSYTSPRNQMQAPPIVVMHDLNLSLESWRQVAVNLSQVGLR-QVITVDARNH 84
            |.:|  .|.||.|||    ..:...|.::.:|....:..|||   ..|.:...| .|:.||.|.:
Human    79 NLKS--SGLRLHYVS----AGRGNGPLMLFLHGFPENWFSWR---YQLREFQSRFHVVAVDLRGY 134

  Fly    85 GLSPYITGHSPMH--------LAADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVI 141
            |.|     .:|..        |..|::.::.....:|.:.:.|..|.......::..|.||||::
Human   135 GPS-----DAPRDVDCYTIDLLLVDIKDVILGLGYSKCILVAHDWGALLAWHFSIYYPSLVERMV 194

  Fly   142 LVDITPAPVPSNFYL--TRQVFE---MMLQVAPSIPSNL-----------SLSEGRTFILPLFQD 190
            :|...|..|..::.|  ..|.|.   |.|...|.:|..|           :|:..:|.|..|   
Human   195 VVSGAPMSVYQDYSLHHISQFFRSHYMFLFQLPWLPEKLLSMSDFQILKTTLTHRKTGIPCL--- 256

  Fly   191 VVHDASELRRIIYNLRKMQDNTFGWAVNPQAVLSSWGEMMINYEATLGGLRP--YMGEVLLIAGS 253
               ..|||...:||..:.     |....|   |:.:..:..|:.     |.|  .....||:.|.
Human   257 ---TPSELEAFLYNFSQP-----GGLTGP---LNYYRNLFRNFP-----LEPQELTTPTLLLWGE 305

  Fly   254 QSEFVTTTSI-AVMQRYFPNTV-VQILDA-GHCVYEDQPEQFVELVVEFTQTCL 304
            :..::....: |:..|:.|..: ..||.. ||.:.:..|::..:.:..|.|..|
Human   306 KDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 67/300 (22%)
Abhydrolase_5 47..>165 CDD:289465 30/131 (23%)
Abhydrolase <249..301 CDD:304388 11/54 (20%)
EPHX3NP_001136358.1 MhpC 80..351 CDD:223669 68/303 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.