DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and ABHD8

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_078803.4 Gene:ABHD8 / 79575 HGNCID:23759 Length:439 Species:Homo sapiens


Alignment Length:272 Identity:61/272 - (22%)
Similarity:99/272 - (36%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 MHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLS--PYITGHSPMH-LAADVEALMSHQRLN 112
            :|.:..||..|::......::|. :|:..|...||.|  |.:......: ||.|:.|:.......
Human   181 IHGVGGSLAIWKEQLDFFVRLGY-EVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKK 244

  Fly   113 KIVALGHGMGGRAMMTLALTQPQLVERVILVD-ITPAPVPSNFYLTRQVFEMMLQVAPSIPSNLS 176
            :.|.:||..|......||...|.||.:||::: ..|..:..:|.   .:|.|...|...:...|:
Human   245 RNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSFC---SIFNMPTCVLHCLSPCLA 306

  Fly   177 ------------------LSEGRTFILPLFQDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAVL 223
                              |.||..|.:..|.               ||.|....: |   |:   
Human   307 WSFLKAGFARQGAKEKQLLKEGNAFNVSSFV---------------LRAMMSGQY-W---PE--- 349

  Fly   224 SSWGEMMINYEATLGGLRPYMGEVLLIAGSQSEFVTTTSIAVMQRYFPNTVVQILDAG-HCVYED 287
               |:.:.:.|.|:        .|||:.|...:||.......|........::::|.| |.|..:
Human   350 ---GDEVYHAELTV--------PVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLE 403

  Fly   288 QPEQFVELVVEF 299
            .||....|:.||
Human   404 CPETVNTLLHEF 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 59/270 (22%)
Abhydrolase_5 47..>165 CDD:289465 30/117 (26%)
Abhydrolase <249..301 CDD:304388 14/52 (27%)
ABHD8NP_078803.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..156
MhpC 156..416 CDD:223669 61/272 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2382
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.