DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and ephx3

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001072430.1 Gene:ephx3 / 779884 XenbaseID:XB-GENE-5900414 Length:367 Species:Xenopus tropicalis


Alignment Length:291 Identity:70/291 - (24%)
Similarity:120/291 - (41%) Gaps:36/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GTRLEYVSYTSPRNQMQAPPIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLS---PY 89
            |.|..||:....||    |.::::|....:..|||......|. |.| .:.:|.|..|.|   ..
 Frog    84 GIRFHYVASGDKRN----PLMLLLHGFPENWYSWRYQLDEFSN-GYR-TVAIDLRGFGGSDAPSR 142

  Fly    90 ITGHSPMHLAADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPV---- 150
            :..:....|..|::.|:.....::.|.:||..||....|.|:....:|..:|::: .|.|.    
 Frog   143 LEDYKMEILLQDLQDLIRGLGYSRCVLVGHDWGGTLAWTFAVRHRDMVTHLIVMN-APHPSAFHD 206

  Fly   151 -----PSNFYLTRQVFEMMLQVAPSIPSNLSLSEGRTFILPLFQDVVHDASELRRIIYNLRKMQD 210
                 ||..:.:|.||...|.:.|.|  .|||.:......|| .|..|.   ::.:...|.|.:.
 Frog   207 YVLSHPSQLFSSRYVFLFQLPLIPEI--LLSLRDFEHIKKPL-TDATHG---IQNVECKLSKEEV 265

  Fly   211 NTFGWAVNPQAVLSSWGEMMINYEATLGGLRPYMGE-----VLLIAGSQSEFVTTTSIAVMQRYF 270
            ..|.:..:.:..|:.    .:||...|.|..|...:     .||:.|....|:....:..||:|.
 Frog   266 EAFVYYPSQKGALTP----PLNYYRNLFGFFPVKAQDVLVPTLLLWGEHDAFLEAAMVPEMQQYV 326

  Fly   271 --PNTVVQILDAGHCVYEDQPEQFVELVVEF 299
              |.....|.:|.|.:.:|:|::..:::.:|
 Frog   327 RAPFRAEIIPNASHWLQQDRPQEVNKIIRDF 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 69/289 (24%)
Abhydrolase_5 47..>165 CDD:289465 30/129 (23%)
Abhydrolase <249..301 CDD:304388 13/53 (25%)
ephx3NP_001072430.1 MhpC 80..359 CDD:223669 70/291 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.