DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and Abhd11

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_660250.1 Gene:Abhd11 / 68758 MGIID:1916008 Length:307 Species:Mus musculus


Alignment Length:268 Identity:81/268 - (30%)
Similarity:132/268 - (49%) Gaps:11/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VSYTSPRNQMQAPPIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLSPYITGHSPMHL 98
            :||.........|.||.:|.|..|..::..:|..:.|...|:|:||||||||.||:....|...:
Mouse    47 LSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAM 111

  Fly    99 AADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVPSNFYLTRQVFEM 163
            :.|::.|:....|...|.:||.|||:..|.|||.:|.:|||:::|||:|.......::...:..|
Mouse   112 SQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAM 176

  Fly   164 MLQVAPSIPSNLSLSEGRTFILPLFQDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAVLSSWGE 228
            .   |..||..:..|:.|.........||.:|...:.::.||.:: ...|.|.:|...:.....:
Mouse   177 K---AVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEV-GGRFSWRLNLDTLAQHLDK 237

  Fly   229 MMINYEATLGGLR-PYMGEVLLIAGSQSEFVTTTSIAVMQRYFPNTVVQ-ILDAGHCVYEDQPEQ 291
            :|     |....| ||.|..|.:.|..|.:|..:..:.::|.||...:| :.:|||.|:.|:|:.
Mouse   238 IM-----TFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQD 297

  Fly   292 FVELVVEF 299
            |::.|..|
Mouse   298 FMDAVTSF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 80/266 (30%)
Abhydrolase_5 47..>165 CDD:289465 42/117 (36%)
Abhydrolase <249..301 CDD:304388 16/52 (31%)
Abhd11NP_660250.1 Abhydrolase_5 60..196 CDD:289465 47/138 (34%)
PRK10673 61..307 CDD:182637 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845921
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2382
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62887
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001908
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1622
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.