DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and Serhl

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_075964.1 Gene:Serhl / 68607 MGIID:1890404 Length:311 Species:Mus musculus


Alignment Length:289 Identity:63/289 - (21%)
Similarity:109/289 - (37%) Gaps:47/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PPIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLSPYITGHSP---MHLAADVEALMS 107
            ||::.:|....:..|:.::...|.|...  .:.:|...||||.:.....|   .:..::|..:.:
Mouse    27 PPVLCLHGWLDNANSFDRLIPLLPQDFC--YMAMDFGGHGLSSHYNPGLPYYQQNFVSEVRRVAT 89

  Fly   108 HQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVPSN------FYLTRQVFEMMLQ 166
            ..:.|:...|||..||....|.|...|::|:::||:|.||..:.||      .|..|.: |..||
Mouse    90 AFKWNQFTLLGHSFGGCVGGTFACMFPEMVDKLILLDSTPFFLDSNEMENILTYRRRNI-EHTLQ 153

  Fly   167 VAPSIPSNLSLSEGRTFILPLFQDVVH---DASEL------RRIIYNLRKMQDNTFGWAVNPQAV 222
            |..|...:|........:.....:..|   |..||      .::...|...:|....|..|....
Mouse   154 VEASQKKSLRAVSPEEMLQGFLNNNSHLDKDCGELILQRGTTKVDAGLVLNRDRRISWPENSFDF 218

  Fly   223 LSSWGEMMINYEATLGGLRPYMGEVLLIAGSQS---------------EFVTTTSIAVMQRYFPN 272
            :|.  ||.::...:|      ...||:|...|.               .|:..|..:.::..|..
Mouse   219 VSK--EMFVHSAKSL------QASVLMIKALQGYYDVRRANDADKAPMHFMVDTLRSTLKERFQF 275

  Fly   273 TVVQILDAGHCVYEDQPEQFVELVVEFTQ 301
            ..|   ...|.::.::|:....:|..|.|
Mouse   276 VEV---PGNHYIHMNKPQVVAGVVGPFLQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 61/285 (21%)
Abhydrolase_5 47..>165 CDD:289465 32/126 (25%)
Abhydrolase <249..301 CDD:304388 10/66 (15%)
SerhlNP_075964.1 MhpC 15..303 CDD:223669 63/289 (22%)
Abhydrolase_5 28..>129 CDD:289465 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.