DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and Bphl

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_080788.1 Gene:Bphl / 68021 MGIID:1915271 Length:291 Species:Mus musculus


Alignment Length:119 Identity:22/119 - (18%)
Similarity:40/119 - (33%) Gaps:29/119 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 APPIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLSPYITGHSPMHL----AADVEAL 105
            ||.:..::....:|.:|                  |.|.:|.|.......|...    |.|...|
Mouse    78 APQLQSLNKKRFTLVAW------------------DPRGYGYSRPPDRDFPRDFFERDAKDAVDL 124

  Fly   106 MSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVPSNFYLTRQ 159
            |...:..::..||...||...:..|...|..:.::::..       :|.|:|.:
Mouse   125 MKALQFKQVSLLGWSDGGITALIAAAKYPSYIRKMVIWG-------ANAYVTEE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 22/119 (18%)
Abhydrolase_5 47..>165 CDD:289465 20/117 (17%)
Abhydrolase <249..301 CDD:304388
BphlNP_080788.1 MhpC 44..291 CDD:223669 22/119 (18%)
Abhydrolase 58..259 CDD:304388 22/119 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.