DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and Abhd5

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_080455.1 Gene:Abhd5 / 67469 MGIID:1914719 Length:351 Species:Mus musculus


Alignment Length:324 Identity:79/324 - (24%)
Similarity:120/324 - (37%) Gaps:85/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GTRLEYVSYTSPRNQMQAPPIVVMHDLNLSLESWRQVAVNLSQVGL-RQVITVDARNHGLSPYIT 91
            |.|:..:.::  .|.....|:|::|.....|..|   |:|...:.. |.|...|....|.|    
Mouse    62 GNRIWTLMFS--HNISSKTPLVLLHGFGGGLGLW---ALNFEDLSTDRPVYAFDLLGFGRS---- 117

  Fly    92 GHSPMHLAADVEALMSH-----------QRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDI 145
              |.....:|.|.:.:.           .||:|::.|||.:||......:|..|..|..:|||: 
Mouse   118 --SRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVE- 179

  Fly   146 TPAPVPSNFYLTRQ----------------VFEMMLQVAPSIPSNLSLSEGRTFILP-------- 186
             |...|....|..|                .|..:..:..:.|..|||.:.   :.|        
Mouse   180 -PWGFPERPDLADQERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQR---LRPDFKRKYSS 240

  Fly   187 LFQDVVHDASELRRIIY--NLRKMQDNT--------FGWAVNPQAVLSSWGEMMINYEATLGGLR 241
            :|:|     ..:...||  |::.....|        :|||..|..             ..:|||.
Mouse   241 MFED-----DTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPML-------------QRIGGLH 287

  Fly   242 PYMGEVLLIAGSQSEFVTTTSIAVMQRYFPNTVVQ---ILDAGHCVYEDQPEQFVELVVEFTQT 302
            |.: .|.:|.|::| .:...|...:|...|.:.|:   ||.|||.||.||||:|.:.|.|...|
Mouse   288 PDI-PVSVIFGARS-CIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 77/319 (24%)
Abhydrolase_5 47..>165 CDD:289465 34/145 (23%)
Abhydrolase <249..301 CDD:304388 21/54 (39%)
Abhd5NP_080455.1 PLN02894 3..347 CDD:215484 78/320 (24%)
HXXXXD motif 329..334 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.