DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and Abhd8

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_071864.2 Gene:Abhd8 / 64296 MGIID:1918946 Length:439 Species:Mus musculus


Alignment Length:277 Identity:59/277 - (21%)
Similarity:99/277 - (35%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 MHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLS--PYITGHSPMH-LAADVEALMSHQRLN 112
            :|.:..||..|::......::|. :|:..|...||.|  |.:......: ||.|:.|:.:.....
Mouse   173 IHGVGGSLAIWKEQLDFFVRLGY-EVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFTRYAKK 236

  Fly   113 KIVALGHGMGGRAMMTLALTQPQLVERVILVD------ITPAPVPSNFYLTRQVFEMMLQVAPSI 171
            :.|.:||..|......||...|.||.:||:::      :.|:        ...:|.|...|...:
Mouse   237 RNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPS--------LCSIFNMPTCVLHCL 293

  Fly   172 PSNLS------------------LSEGRTFILPLFQDVVHDASELRRIIYNLRKMQDNTFGWAVN 218
            ...|:                  |.||..|.:..|.               ||.|....: |   
Mouse   294 SPCLAWSFLKAGFARQGAKEKQLLKEGNAFNVSSFV---------------LRAMMSGQY-W--- 339

  Fly   219 PQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAGSQSEFVTTTSIAVMQRYFPNTVVQILDAG-H 282
            |:      |:.:.:.|.|:        .|||:.|...:||.......|........:::::.| |
Mouse   340 PE------GDEVYHAELTV--------PVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIEEGSH 390

  Fly   283 CVYEDQPEQFVELVVEF 299
            .|..:.||....|:.||
Mouse   391 MVMLECPETVNTLLHEF 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 57/275 (21%)
Abhydrolase_5 47..>165 CDD:289465 29/122 (24%)
Abhydrolase <249..301 CDD:304388 13/52 (25%)
Abhd8NP_071864.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..148
MhpC 149..408 CDD:223669 59/277 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..439
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2382
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.