DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and ABHD4

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_071343.2 Gene:ABHD4 / 63874 HGNCID:20154 Length:342 Species:Homo sapiens


Alignment Length:301 Identity:70/301 - (23%)
Similarity:109/301 - (36%) Gaps:66/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SPRNQMQAPPIVVMHDLNLSLESWRQVAVNLSQVGLRQVI-TVDARNHGLS-----PYITGHSPM 96
            || .|....|:|::|.....:..|   .:|:..:..|:.: |.|....|.|     |.....:..
Human    62 SP-EQNDRTPLVMVHGFGGGVGLW---ILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAED 122

  Fly    97 HLAADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPV-PSN------- 153
            .....:|.......:..::.|||.:||....:.::..|..|:.:||||....|: |:|       
Human   123 EFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAP 187

  Fly   154 --------FYLTRQVFEMMLQVA----PSIPSNLSLSEGRTFILPLFQDVVHDASELRRIIYNLR 206
                    ..|.|.....:|:||    |.:.........|.| ...|:|     ..:...||:..
Human   188 PAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKF-ADFFED-----DTISEYIYHCN 246

  Fly   207 ----------KMQDNTFGWAVNPQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAGSQSEFVTTT 261
                      |....:||||..|......    :|..:.          .:.:|.||.:...|:|
Human   247 AQNPSGETAFKAMMESFGWARRPMLERIH----LIRKDV----------PITMIYGSDTWIDTST 297

  Fly   262 SIAV-MQRYFPNTVV---QILDAGHCVYEDQPEQFVELVVE 298
            ...| |||  |::.|   :|..|.|.||.|||..|..:|.|
Human   298 GKKVKMQR--PDSYVRDMEIKGASHHVYADQPHIFNAVVEE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 70/301 (23%)
Abhydrolase_5 47..>165 CDD:289465 28/139 (20%)
Abhydrolase <249..301 CDD:304388 22/54 (41%)
ABHD4NP_071343.2 PLN02894 8..338 CDD:215484 70/301 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.