Sequence 1: | NP_001262481.1 | Gene: | CG14717 / 41412 | FlyBaseID: | FBgn0265271 | Length: | 306 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001009617.1 | Gene: | Mest / 58827 | RGDID: | 1594589 | Length: | 335 | Species: | Rattus norvegicus |
Alignment Length: | 274 | Identity: | 56/274 - (20%) |
---|---|---|---|
Similarity: | 99/274 - (36%) | Gaps: | 84/274 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 APPIVV-MHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLS--PYITGHSPMHLAADVEALM 106
Fly 107 SHQRL--NKIVALGHGMG----------------GR-AMMTLALT---------QPQLVERVILV 143
Fly 144 DITPAPVPS---NFYL------------TRQVFEMMLQVAPSIPSNLSLSEGRTFILPLFQDVVH 193
Fly 194 DASELRR--------------IIY----------NLRKMQDNTFGWAVNPQAVLSSWGEMMINY- 233
Fly 234 --EATLGGLRPYMG 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14717 | NP_001262481.1 | MhpC | 28..299 | CDD:223669 | 56/274 (20%) |
Abhydrolase_5 | 47..>165 | CDD:289465 | 35/163 (21%) | ||
Abhydrolase | <249..301 | CDD:304388 | |||
Mest | NP_001009617.1 | MhpC | 47..321 | CDD:223669 | 51/263 (19%) |
RVIALD | 98..103 | 2/4 (50%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1268438at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |