DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and Mest

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001009617.1 Gene:Mest / 58827 RGDID:1594589 Length:335 Species:Rattus norvegicus


Alignment Length:274 Identity:56/274 - (20%)
Similarity:99/274 - (36%) Gaps:84/274 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 APPIVV-MHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLS--PYITGHSPMHLAADVEALM 106
            :|.||| :|....|...|.::...|: :...:||.:|....|.|  |....:|....|:.||:|:
  Rat    68 SPEIVVLLHGFPTSSYDWYKIWEGLT-LRFHRVIALDFLGFGFSDKPRPHQYSIFEQASIVESLL 131

  Fly   107 SHQRL--NKIVALGHGMG----------------GR-AMMTLALT---------QPQLVERVILV 143
            .|..|  .:|..|.|..|                || .:.:|.|:         :|.|:::::..
  Rat   132 RHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKD 196

  Fly   144 DITPAPVPS---NFYL------------TRQVFEMMLQVAPSIPSNLSLSEGRTFILPLFQDVVH 193
            ....:|:.:   ||::            ||.....:..:...|.:|    :|...|..|.| .::
  Rat   197 GGVLSPILTRLMNFFVFSRGLTPVFGPYTRPTESELWDMWAGIRNN----DGNLVIDSLLQ-YIN 256

  Fly   194 DASELRR--------------IIY----------NLRKMQDNTFGWAVNPQAVLSSWGEMMINY- 233
            ...:.||              .||          ...::...|.     |::.:|...:.:.:| 
  Rat   257 QRKKFRRRWVGALASVTIPIHFIYGPLDPINPYPEFLELYRKTL-----PRSTVSILDDHISHYP 316

  Fly   234 --EATLGGLRPYMG 245
              |..:|.|..|||
  Rat   317 QLEDPMGFLNAYMG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 56/274 (20%)
Abhydrolase_5 47..>165 CDD:289465 35/163 (21%)
Abhydrolase <249..301 CDD:304388
MestNP_001009617.1 MhpC 47..321 CDD:223669 51/263 (19%)
RVIALD 98..103 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1268438at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.