DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and ABHD6

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_005265391.1 Gene:ABHD6 / 57406 HGNCID:21398 Length:338 Species:Homo sapiens


Alignment Length:331 Identity:68/331 - (20%)
Similarity:117/331 - (35%) Gaps:112/331 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GTRLEYV-------SYTSPRNQMQAPPIVVMHDLNLSLESWRQVA----VNLSQVGLRQVITVDA 81
            |.::.||       .|:........|.|:::|..:...:.|..|.    .||      .::.||.
Human    47 GMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNL------HLVCVDM 105

  Fly    82 RNHGLSPYITGHSPMHLAADVEALMSHQ-----RLNK--IVALGHGMGGRA-----------MMT 128
            ..|   ...|..|...|:.|.:....||     :|||  ...:|..|||:.           :.:
Human   106 PGH---EGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSS 167

  Fly   129 LALTQP---------------------QLVERVILVDITPAPVPS--------NFYLTRQVFEMM 164
            |.|..|                     ..||::.|:..||..:..        .|.:.:|:.:.:
Human   168 LCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGL 232

  Fly   165 LQVAPSIPSNLSLSEGRTFILPLFQDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAVLSSWGEM 229
            :.|  .||.|       .|...||.::|.:.|.     |:|.:..|..   .|..|.:   ||:.
Human   233 VDV--RIPHN-------NFYRKLFLEIVSEKSR-----YSLHQNMDKI---KVPTQII---WGKQ 277

  Fly   230 MINYEATLGGLRPYMGEVLLIAGSQSEFVTTTSIAVMQRYFPNTVVQILD-AGHCVYEDQPEQFV 293
                          ..:||.::|:.   :...|||       |..|::|: .||.|..::|.:..
Human   278 --------------DQQVLDVSGAD---MLAKSIA-------NCQVELLENCGHSVVMERPRKTA 318

  Fly   294 ELVVEF 299
            :|:::|
Human   319 KLIIDF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 67/329 (20%)
Abhydrolase_5 47..>165 CDD:289465 32/168 (19%)
Abhydrolase <249..301 CDD:304388 13/52 (25%)
ABHD6XP_005265391.1 MhpC 51..328 CDD:223669 67/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.