DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and LOC570571

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_021330474.1 Gene:LOC570571 / 570571 -ID:- Length:355 Species:Danio rerio


Alignment Length:306 Identity:71/306 - (23%)
Similarity:117/306 - (38%) Gaps:79/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GTRLEYVSYTSPRNQMQAPPIVVMHDL--NLSLESWRQVAVNLSQVGLRQVITVDARNHGLSPYI 90
            |.|..||:    :...:.|.::.:|..  |....|||...:..|  |....:.:|.|..|.|   
Zfish    84 GLRFHYVT----KGDHKKPLMLFLHGFPENCCRYSWRHQLLEFS--GDFHTVALDLRGCGAS--- 139

  Fly    91 TGHSPMH--------LAADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITP 147
              .:|:.        |..|:...:........:.:||..||......||.:|.:|:.:|:::   
Zfish   140 --DAPVRLEDYLLEALLYDIRDTVDQLGHTSCILVGHDWGGMLAWHFALERPDMVQLLIVMN--- 199

  Fly   148 APVPSNFY---LTRQV------FEMMLQVAPSI-----------PSNLSLSEGRTFILPLFQ--D 190
            ||.|:::.   |.|.|      |.::|.:..|:           ...|:.|:...::.||.|  .
Zfish   200 APHPASWLGKKLFRPVIISLLFFNIVLHLVRSLFCGKNVGIRNRSRRLTESQLEGYLYPLSQPGG 264

  Fly   191 VVHDASELRRIIYN-LRKMQDNTFGWAVNPQAVLSSWGEM-MINYEATLGGLRPYMGEVLLIAGS 253
            :....:..|.::.| |.|.||     ...|..::  |||. .|..|...||.|||      :.| 
Zfish   265 LTAPLNYFRSLLSNTLYKHQD-----VAVPCMLI--WGEADNILVEGMSGGTRPY------VRG- 315

  Fly   254 QSEFVTTTSIAVMQRYFPNTVVQILDAGHCVYEDQPEQFVELVVEF 299
                             |.|:..|.:..|.|.:||||...:|:.:|
Zfish   316 -----------------PVTIHTIPECSHWVQQDQPEIVNKLIWDF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 70/304 (23%)
Abhydrolase_5 47..>165 CDD:289465 30/136 (22%)
Abhydrolase <249..301 CDD:304388 12/51 (24%)
LOC570571XP_021330474.1 MhpC 82..341 CDD:223669 69/301 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.