DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and ABHD5

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001342115.1 Gene:ABHD5 / 51099 HGNCID:21396 Length:349 Species:Homo sapiens


Alignment Length:304 Identity:72/304 - (23%)
Similarity:112/304 - (36%) Gaps:81/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PIVVMHDLNLSLESWRQVAVNLSQVGL-RQVITVDARNHGLSPYITGHSPMHLAADVEALMSH-- 108
            |:|::|.....|..|   |:|...:.. |.|...|....|.|      |.....:|.|.:.:.  
Human    77 PLVLLHGFGGGLGLW---ALNFGDLCTNRPVYAFDLLGFGRS------SRPRFDSDAEEVENQFV 132

  Fly   109 ---------QRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVPSNFYLTRQ----- 159
                     ..|:|::.|||.:||......:|..|..|..:|||:  |...|....|..|     
Human   133 ESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVE--PWGFPERPDLADQDRPIP 195

  Fly   160 -----------VFEMMLQVAPSIPSNLSLSEGRTFILP--------LFQDVVHDASELRRIIY-- 203
                       .|..:..:..:.|..|||.:.   :.|        :|:|     ..:...||  
Human   196 VWIRALGAALTPFNPLAGLRIAGPFGLSLVQR---LRPDFKRKYSSMFED-----DTVTEYIYHC 252

  Fly   204 NLRKMQDNT--------FGWAVNPQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAGSQS--EFV 258
            |::.....|        :|||..|..             ..:|.:.|.: .|.:|.|::|  :..
Human   253 NVQTPSGETAFKNMTIPYGWAKRPML-------------QRIGKMHPDI-PVSVIFGARSCIDGN 303

  Fly   259 TTTSIAVMQRYFPNTVVQILDAGHCVYEDQPEQFVELVVEFTQT 302
            :.|||..::.:.....:.||.|||.||.||||:|.:.|.|...|
Human   304 SGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 70/299 (23%)
Abhydrolase_5 47..>165 CDD:289465 33/145 (23%)
Abhydrolase <249..301 CDD:304388 20/53 (38%)
ABHD5NP_001342115.1 Abhydrolase_1 1..345 CDD:331148 71/300 (24%)
HXXXXD motif 327..332 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.