DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and Serhl2

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_008763997.1 Gene:Serhl2 / 500911 RGDID:1563386 Length:328 Species:Rattus norvegicus


Alignment Length:327 Identity:67/327 - (20%)
Similarity:126/327 - (38%) Gaps:71/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VSYTSPRNQMQAP-PIVVMHDLNLSLESWRQVAVNLSQVGLRQ---------------------- 75
            ::|:|..::..:| |:.::.:|.|:: .|..:||.:  .||::                      
  Rat     4 LAYSSRWSRHSSPSPLGLLSELKLAV-PWGHIAVKV--WGLQKNPPVLCLHGWLDNANSFDKLIP 65

  Fly    76 -------VITVDARNHGLSPYITGHSPMH---LAADVEALMSHQRLNKIVALGHGMGGRAMMTLA 130
                   .:.:|...||||.:.:...|.:   ..::|..::|..:..::..|||..||......|
  Rat    66 FLPKDFCYVAMDFGGHGLSTHYSPGLPYYHHNFVSEVRRVVSAFKWTRLSLLGHSFGGVVGGLFA 130

  Fly   131 LTQPQLVERVILVDITPAPVPSN-----FYLTRQVFEMMLQVAPS--IPSNLSLSEGRTFILPLF 188
            ...|::|:::||:|.||..:..|     ....|:..|..|:|..|  .|...|..|....:|...
  Rat   131 CMFPEMVDKLILLDSTPLLMDLNEVENIMTYRRKNIEQTLKVEDSQKPPGIFSPEEMLHELLTKN 195

  Fly   189 QDVVHDASEL------RRIIYNLRKMQDNTFGWAVNPQAVLSSWGEMMINYEATLGGLRPYMGEV 247
            ..:..|..||      .::...|...:|....|   ||......|:     |.|:..||.....|
  Rat   196 SHLNEDCGELLLQRGTTKVAEGLVLNRDQRLSW---PQYSFDFMGK-----ELTMHSLRRLQASV 252

  Fly   248 LLIAGSQSEF-------VTTTSIAVMQRYFPNTV------VQILDAGHCVYEDQPEQFVELVVEF 299
            |:|......:       :...|..:|.....:|:      |:| ...|.::.::|:...:::..|
  Rat   253 LIIKALDGYYDVRRENDLNKASFLLMLDILRSTLKERFQFVEI-PGNHYIHMNKPQIVADIIRSF 316

  Fly   300 TQ 301
            .|
  Rat   317 LQ 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 65/323 (20%)
Abhydrolase_5 47..>165 CDD:289465 32/154 (21%)
Abhydrolase <249..301 CDD:304388 9/64 (14%)
Serhl2XP_008763997.1 MhpC 33..320 CDD:223669 60/297 (20%)
Abhydrolase_5 46..>155 CDD:289465 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.