DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and serhl

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_031755888.1 Gene:serhl / 493433 XenbaseID:XB-GENE-5751959 Length:309 Species:Xenopus tropicalis


Alignment Length:292 Identity:67/292 - (22%)
Similarity:109/292 - (37%) Gaps:70/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LNLSLESWRQVAVNLSQV------GLRQVITVDARNHGLSPYITGHSPMHLAAD--------VEA 104
            |.|.|..|...|.:.:::      |...| .:|...||||    .|.|.....|        .:|
 Frog    35 LVLCLHGWLDNANSFNKLIPLLPQGYHYV-ALDFTGHGLS----SHKPPGARYDFIDFVIDAYKA 94

  Fly   105 LMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVP-------SNF------YL 156
            |::..| .|:..|||.:||.....||...|:::|.|||:| |....|       |:|      |:
 Frog    95 LVALGR-EKVTVLGHSLGGLVGTLLASIYPEIIENVILLD-TYGFYPQSSHIFISHFKDSILSYV 157

  Fly   157 TRQVFEMMLQVAPS------IPSNLSLSEGRTFILPLFQDVVHDASELRRIIYNLRKMQDN-TFG 214
            ...|.::.....|.      :.:|.||:.....||            |:|   ..::|.|. || 
 Frog   158 CTDVAQVQKTYTPGDALQRLLIANKSLTVESVKIL------------LQR---GTKEMPDGLTF- 206

  Fly   215 WAVNPQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAGS-------QSEFVT---TTSIAVMQRY 269
             ..:|:..|.|...:.:  |.....::.....||.|..|       :::|..   |..::..|.|
 Frog   207 -TRDPRICLMSMPPLTL--ELCCHMMKTIQANVLAIIASDGLMSEKENQFDPRDGTILLSRWQEY 268

  Fly   270 FPNTVVQILDAGHCVYEDQPEQFVELVVEFTQ 301
            .....:..::..|.|:.:..|....::..|.|
 Frog   269 VECFQLAAVNGNHFVHLNNAENVSGIISSFLQ 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 65/288 (23%)
Abhydrolase_5 47..>165 CDD:289465 38/137 (28%)
Abhydrolase <249..301 CDD:304388 10/61 (16%)
serhlXP_031755888.1 Abhydrolase_1 35..>134 CDD:395444 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.