DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and CG5704

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001286912.1 Gene:CG5704 / 48613 FlyBaseID:FBgn0026570 Length:335 Species:Drosophila melanogaster


Alignment Length:292 Identity:55/292 - (18%)
Similarity:119/292 - (40%) Gaps:51/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RNQMQAPPIVVMHDLNLSLESW-RQVAVNLSQVGLRQVITVDARNHGLSPYITG---HSPMHLAA 100
            ||:.   ||:.:|....:|.:: |.:.:....:|   |:.:|...||.|.::..   :|......
  Fly    29 RNER---PILAIHGWLDNLGTFDRLIPLLPDYLG---VLCIDLPGHGRSSHLPPGMYYSVYEYVF 87

  Fly   101 DVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVPSNF-YLTRQVFEMM 164
            .:..:|.....:|:..:||.:||......|...|..|:.::.:||. .|:.::. |:...:.:.:
  Fly    88 TIPLVMKEYGWSKVSLIGHSLGGVLSFIYASLAPHTVDMIVSLDIL-LPLRNDIDYMDLSIEKQL 151

  Fly   165 LQV----------APSIPSNLSLSEGRTFILPLFQDVVHDASELRRIIYNLR----KMQDNTFGW 215
            :.|          .||...|   ..|:......|..|   :.||.:.:.:.:    |:....|.:
  Fly   152 VNVERQKLGNYIEPPSYTHN---QLGKVLAAGSFNSV---SPELAKHLLHRQLAKSKLYPERFYF 210

  Fly   216 AVNPQAVLSSWGEMMINYEATLGG-------LRPYMGEVLLIAGSQSEFVT---TTSIAVMQRYF 270
            ..:.:.....:    |:.:.:||.       .:||    |:|.||.|.:::   ..:|:::.:..
  Fly   211 TRDIRVKYYHY----IDIDDSLGAEMARRIIKKPY----LIIKGSLSPYLSVRNNEAISILAKDN 267

  Fly   271 PN-TVVQILDAGHCVYEDQPEQFVELVVEFTQ 301
            |: ...::.:..|.::....|:....:|.|.|
  Fly   268 PHFEFYEVENGTHHLHLHAAEECAGYIVPFIQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 53/288 (18%)
Abhydrolase_5 47..>165 CDD:289465 25/122 (20%)
Abhydrolase <249..301 CDD:304388 10/55 (18%)
CG5704NP_001286912.1 MhpC 32..301 CDD:223669 53/289 (18%)
Abhydrolase_5 33..>121 CDD:289465 19/90 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.