DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and CG5377

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_651052.1 Gene:CG5377 / 42645 FlyBaseID:FBgn0038974 Length:278 Species:Drosophila melanogaster


Alignment Length:209 Identity:36/209 - (17%)
Similarity:61/209 - (29%) Gaps:84/209 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 ERVILVDITPAPVPSNFYLTRQVFEMMLQVAP--------------SIPSNLSLSEGRTFILPLF 188
            ||.:|  :.|..:.|::...|...|.:.::.|              |:|..      |.|.|..|
  Fly    42 ERSLL--LMPGALGSSWTDFRPQIEQLPKLLPGHTIIAWDPPGYGKSVPPQ------RKFGLEFF 98

  Fly   189 QDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAGS 253
            ::....|.:|.|.:              ..|:..:..|.:         ||:     ..|::||.
  Fly    99 REDAQAAVDLMRAL--------------DRPRFSILGWSD---------GGI-----TALIVAGR 135

  Fly   254 QSEFVTTTSIAVMQRY----------------------------------FPNTVVQILDAGHCV 284
            .:|.|...:|.....|                                  ||....:.:||....
  Fly   136 HAEAVDRLAIWGAGAYLNADEVKALKNIRDVAKWSPRMREPMEKVYGVERFPQLWAEWVDAACAF 200

  Fly   285 YEDQPEQFVELVVE 298
            |:.:...|....||
  Fly   201 YDQRDGDFCRTEVE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 36/209 (17%)
Abhydrolase_5 47..>165 CDD:289465 7/26 (27%)
Abhydrolase <249..301 CDD:304388 14/84 (17%)
CG5377NP_651052.1 MhpC 26..274 CDD:223669 36/209 (17%)
Abhydrolase_5 45..257 CDD:289465 34/206 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.