DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and CG5377

DIOPT Version :10

Sequence 1:NP_650106.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_651052.1 Gene:CG5377 / 42645 FlyBaseID:FBgn0038974 Length:278 Species:Drosophila melanogaster


Alignment Length:209 Identity:36/209 - (17%)
Similarity:61/209 - (29%) Gaps:84/209 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 ERVILVDITPAPVPSNFYLTRQVFEMMLQVAP--------------SIPSNLSLSEGRTFILPLF 188
            ||.:|  :.|..:.|::...|...|.:.::.|              |:|..      |.|.|..|
  Fly    42 ERSLL--LMPGALGSSWTDFRPQIEQLPKLLPGHTIIAWDPPGYGKSVPPQ------RKFGLEFF 98

  Fly   189 QDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAGS 253
            ::....|.:|.|.:              ..|:..:..|.:         ||:     ..|::||.
  Fly    99 REDAQAAVDLMRAL--------------DRPRFSILGWSD---------GGI-----TALIVAGR 135

  Fly   254 QSEFVTTTSIAVMQRY----------------------------------FPNTVVQILDAGHCV 284
            .:|.|...:|.....|                                  ||....:.:||....
  Fly   136 HAEAVDRLAIWGAGAYLNADEVKALKNIRDVAKWSPRMREPMEKVYGVERFPQLWAEWVDAACAF 200

  Fly   285 YEDQPEQFVELVVE 298
            |:.:...|....||
  Fly   201 YDQRDGDFCRTEVE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_650106.1 MenH 26..299 CDD:440361 36/209 (17%)
CG5377NP_651052.1 MenH 22..277 CDD:440361 36/209 (17%)

Return to query results.
Submit another query.