DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and CG11309

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649301.1 Gene:CG11309 / 40356 FlyBaseID:FBgn0037070 Length:358 Species:Drosophila melanogaster


Alignment Length:265 Identity:50/265 - (18%)
Similarity:91/265 - (34%) Gaps:65/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ITVDARNHGLSP------YITGHSPMHLAADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQ 135
            :.:|...||||.      |......:::   :..:|...:..|:..:||.|........|...|.
  Fly    97 LAIDLPGHGLSSRLPDGCYYNSVDNLYV---IRLIMKQYKWEKVSLVGHSMSSIICFVFAAVFPD 158

  Fly   136 LVERVILVD-ITP--APVPSNFYLTRQVFEMMLQVAPSIPSNLSLSEGRTF-----ILPLFQDVV 192
            .|:.:|.:| :.|  .|.||   :.|.:...:.:.......|.|.:|..::     |..::....
  Fly   159 KVDMIIGIDALKPHQRPYPS---VIRTMETRLDEFLREDERNRSKNEPPSYTYDELIERVYIGTF 220

  Fly   193 HDASE------LRRIIYNLRKMQDNTF----------GWAVNPQAVLSSWGEMMINYEATLGGLR 241
            |..::      :.|.|....|..|..|          .:|:..|       |:.:.....:  ..
  Fly   221 HSVNKEHCKHLMARNIGKSEKYPDKYFFCRDRRLKFYNYAIGSQ-------ELCVEMANRI--TC 276

  Fly   242 PYMGEVLLIAGSQSEFVTTTSIAVMQRYF----------PNTVVQILDAGHCVYEDQPEQFVELV 296
            ||    |.|..:||.:...      ::|:          ||.....::..|.|:.:.||..:..|
  Fly   277 PY----LFIKAAQSSYFED------KKYYDEVLDVLLKKPNFEYLEVNGSHHVHMNDPEAIIAPV 331

  Fly   297 VEFTQ 301
            ..|.|
  Fly   332 NNFIQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 48/261 (18%)
Abhydrolase_5 47..>165 CDD:289465 21/96 (22%)
Abhydrolase <249..301 CDD:304388 12/61 (20%)
CG11309NP_649301.1 MhpC 68..337 CDD:223669 50/265 (19%)
Abhydrolase_5 73..>158 CDD:289465 12/63 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.