DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and CG5068

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster


Alignment Length:340 Identity:66/340 - (19%)
Similarity:122/340 - (35%) Gaps:94/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YTSPRNQMQAPPIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLSPYITGHSPMH--- 97
            |.:.:.:...|.::::|....|..:|......::.:...|.:.:|.|.||.|. :.....:.   
  Fly    62 YRTKQPEKPGPVLLLLHGGGYSALTWAHFCSEVTSMIHCQCLCIDMRGHGDSK-VDDEDDLSADT 125

  Fly    98 LAADVEAL---MSHQRLNKIVALGHGMGGR-----AMMTLALTQPQLVERVILVDITPAPV---- 150
            ||.|:..|   :..:.:.::..:||.|||.     |.|.|.   |.|: .:.::|:.....    
  Fly   126 LAKDIGDLILKLYPEEVPQLFVVGHSMGGAIAVHFAHMALV---PNLI-GITVIDVVEGTAMEAL 186

  Fly   151 ----------PSNFYLTRQVFEMMLQ---------VAPSIPS---NLSLSEGRTFILPLFQDVVH 193
                      |..|.......|..::         ...|:|.   |.:.::..|..|||..||:.
  Fly   187 ASMQSFLRSRPKYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLATNDLPLPDDVLE 251

  Fly   194 DA-----------------------------SELRRIIYNLRKMQDNT----------FGWAVNP 219
            :|                             ||......:.:|  .||          :.|.:: 
  Fly   252 EAHHNSMFPNPFSISEDEESSPPGDDAADGSSESAAAGADFKK--PNTTKSTTEAAKNYTWRID- 313

  Fly   220 QAVLSSWGEMMINYEATLGG--LRPYMGEVLLIAGSQSEFVTTTSIAVMQRYFPNTVVQIL-DAG 281
               ||...:..:.:.:.|..  |...:.:.||:| |......|.::..||..|.   :|:| ..|
  Fly   314 ---LSKSEKYWVGWFSGLSDKFLNLRLPKQLLLA-SIDGLDRTLTVGQMQGRFQ---MQVLARCG 371

  Fly   282 HCVYEDQPEQFVELV 296
            |.|:||:|.:..|::
  Fly   372 HAVHEDRPHEVAEVI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 66/340 (19%)
Abhydrolase_5 47..>165 CDD:289465 27/142 (19%)
Abhydrolase <249..301 CDD:304388 16/49 (33%)
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 27/138 (20%)
Abhydrolase_5 73..>161 CDD:289465 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.