DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and CG15820

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_647696.1 Gene:CG15820 / 38277 FlyBaseID:FBgn0035312 Length:308 Species:Drosophila melanogaster


Alignment Length:323 Identity:63/323 - (19%)
Similarity:120/323 - (37%) Gaps:83/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RLEYVSYTSPRNQMQAP---------------PIVVMHDLNLSLESW-RQVAVNLSQVGLRQVIT 78
            ||:|.....|     ||               ||:.:|....:|.:: |.:.:....:|   |:.
  Fly     4 RLQYEEVMIP-----APWGHIAGRWYGNRADRPILAIHGWLDNLGTFDRLIPLLPDYIG---VLC 60

  Fly    79 VDARNHGLSPYITGHSPMHL---AADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERV 140
            :|...||.|..:....|.::   ...:..:|.....:|:..:||.:||......|...|..|:.:
  Fly    61 IDLPGHGRSSRLPPGVPYNVYDYVFIIPRVMKEFGWSKVSLMGHSLGGVMSFMYAAMAPSTVDMI 125

  Fly   141 ILVDI-TPAPVPSNFYLTRQVFEMMLQVAPSI------PSNLSLSEGRTFI-------LP----- 186
            |.:|: .|..:.....||:.:...:|:.....      |.:.:||:.|..:       :|     
  Fly   126 ISLDVLLPRRIEDPSKLTKDIEGYLLEERRQADGTEHEPPSFTLSKLRETLARNSNNSVPQHLAD 190

  Fly   187 -----------LFQDVVHDASELRRIIYNLRKMQDNTFGWAVNPQAVLSSWGEMMINYEATLGGL 240
                       ::.:.|..:.:.|...|::..:::   |.|:          ||....|.     
  Fly   191 HMLHRQVAKSNMYPEKVFFSRDGRVKFYHIFDIEN---GLAL----------EMARRIEK----- 237

  Fly   241 RPYMGEVLLIAGSQSEFV---TTTSIAVMQRYFPNTVVQILDAG-HCVYEDQPEQFVELVVEF 299
            :||    |:|.||.|.||   ...:::::....||.....::.| |.|:....|:....:|.|
  Fly   238 KPY----LVIKGSLSPFVGPRCNETMSILSHDNPNFEFYEVEGGKHHVHLHAAEECARYIVPF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 62/321 (19%)
Abhydrolase_5 47..>165 CDD:289465 26/122 (21%)
Abhydrolase <249..301 CDD:304388 14/55 (25%)
CG15820NP_647696.1 MhpC 24..300 CDD:223669 57/298 (19%)
Abhydrolase_5 31..>119 CDD:289465 19/90 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439874
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.