DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and puml

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster


Alignment Length:311 Identity:66/311 - (21%)
Similarity:115/311 - (36%) Gaps:76/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SPRNQMQAPPIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLSPYIT-----GHSPMH 97
            |...:.:..|:|::|.|...:..|              |:.:||...|...|..     |.|...
  Fly   105 SMNTESKEVPLVLLHGLGAGIALW--------------VMNLDAFAKGRPVYAMDILGFGRSSRP 155

  Fly    98 LAA------------DVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPV 150
            |.|            .||.......:|.::.|||.|||....:.||:.|:.|:.:||.|....|.
  Fly   156 LFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPE 220

  Fly   151 PSNFYLTRQVFEMMLQVAPSIPSNLS---------------LSEGRTFILPLFQDVV-HDASELR 199
            ..:.....:...:.::....:.:.|:               :.:.|..|:..||..: .|.:.|.
  Fly   221 KPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLP 285

  Fly   200 RIIYNLRKMQDN----------TFGWAVNPQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAGSQ 254
            :.|:.......:          :||||.:|          ||:....:....|    :..|.||:
  Fly   286 QYIHQCNAQNPSGESAFHTMMQSFGWAKHP----------MIHRIKDVRSDIP----ITFIYGSR 336

  Fly   255 SEFVTTTSIAVMQRYFPNTV-VQIL-DAGHCVYEDQPEQFVELVVEFTQTC 303
            |...:::...:..:...|.| ::|: .|||.||.|:|:.|...|   .:||
  Fly   337 SWIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYV---NETC 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 64/305 (21%)
Abhydrolase_5 47..>165 CDD:289465 31/134 (23%)
Abhydrolase <249..301 CDD:304388 16/53 (30%)
pumlNP_001286169.1 MhpC 114..382 CDD:223669 63/298 (21%)
Abhydrolase_5 114..>226 CDD:289465 31/125 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.