DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and kraken

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001259847.1 Gene:kraken / 33265 FlyBaseID:FBgn0020545 Length:331 Species:Drosophila melanogaster


Alignment Length:282 Identity:56/282 - (19%)
Similarity:103/282 - (36%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PIVVMHDLNLSLESWRQVAVNLSQV-----GLRQVITVDARNHGLSPYITGHSPMHL-------- 98
            ||:.:|       .|:....:..::     ....::.:|...||.|    .|.||.:        
  Fly    63 PIIALH-------GWQDNCGSFDRLCPLLPADTSILAIDLPGHGKS----SHYPMGMQYFIFWDG 116

  Fly    99 AADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVPSNFYL---TRQV 160
            ...:..::.......:..|||.:||......|.:.|..||::|.:||....|.....:   |.:.
  Fly   117 ICLIRRIVRKYNWKNVTLLGHSLGGALTFMYAASFPTEVEKLINIDIAGPTVRGTQRMAEGTGRA 181

  Fly   161 FEMMLQVAPSIPSN----LSLSEGRTFILPLFQDVVHDASELRRIIYNLRKMQDNT----FGWAV 217
            .:..|.. .::|.:    .|..|....:|..:...|.:.|.  |::.| |.|:.|.    :.:|.
  Fly   182 LDKFLDY-ETLPESKQPCYSYDEMIKLVLDAYDGSVDEPSV--RVLMN-RGMRHNPSKNGYLFAR 242

  Fly   218 NPQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAG-----SQSEFVTTTSIAVMQRYFPNTVVQI 277
            :.:..:|..|  |...|.||...|.....||.|.|     .::..|....||.::......|...
  Fly   243 DLRLKVSLLG--MFTAEQTLAYARQIRCRVLNIRGIPGMKFETPQVYADVIATLRENAAKVVYVE 305

  Fly   278 LDAGHCVYEDQPEQFVELVVEF 299
            :...|.::...|::....::.|
  Fly   306 VPGTHHLHLVTPDRVAPHIIRF 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 55/280 (20%)
Abhydrolase_5 47..>165 CDD:289465 25/133 (19%)
Abhydrolase <249..301 CDD:304388 9/56 (16%)
krakenNP_001259847.1 MhpC 61..329 CDD:223669 56/282 (20%)
Abhydrolase_5 63..>159 CDD:289465 20/106 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.