DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and Abhd5

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_997689.1 Gene:Abhd5 / 316122 RGDID:1303237 Length:351 Species:Rattus norvegicus


Alignment Length:311 Identity:77/311 - (24%)
Similarity:114/311 - (36%) Gaps:83/311 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NQMQAPPIVVMHDLNLSLESWRQVAVNLSQVGL-RQVITVDARNHGLSPYITGHSPMHLAADVEA 104
            |.....|:|::|.....|..|   |:|...:.. |.|...|....|.|      |.....:|.|.
  Rat    73 NMSSKTPLVLLHGFGGGLGLW---ALNFEDLSTDRPVYAFDLLGFGRS------SRPRFDSDAEE 128

  Fly   105 LMSH-----------QRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVPSNFYLTR 158
            :.:.           .||:|::.|||.:||......:|..|..|..:|||:  |...|....|..
  Rat   129 VENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVE--PWGFPERPDLAD 191

  Fly   159 Q----------------VFEMMLQVAPSIPSNLSLSEGRTFILP--------LFQDVVHDASELR 199
            |                .|..:..:..:.|..|||.:.   :.|        :|:|     ..:.
  Rat   192 QERPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQR---LRPDFKRKYSSMFED-----DTVT 248

  Fly   200 RIIY--NLRKMQDNT--------FGWAVNPQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAGSQ 254
            ..||  |::.....|        :|||..|..             ..:|||.|.: .|.:|.|::
  Rat   249 EYIYHCNVQTPSGETAFKNMTIPYGWAKRPML-------------QRIGGLHPDI-PVSVIFGAR 299

  Fly   255 SEFVTTTSIAVMQRYFPNTVVQ---ILDAGHCVYEDQPEQFVELVVEFTQT 302
            | .:...|...:|...|.:.|:   ||.|||.||.||||:|.:.|.|...|
  Rat   300 S-CIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHT 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 75/306 (25%)
Abhydrolase_5 47..>165 CDD:289465 34/145 (23%)
Abhydrolase <249..301 CDD:304388 21/54 (39%)
Abhd5NP_997689.1 PLN02894 3..347 CDD:215484 76/307 (25%)
HXXXXD motif 329..334 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42886
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.