DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and mest

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_571118.2 Gene:mest / 30242 ZFINID:ZDB-GENE-991111-5 Length:344 Species:Danio rerio


Alignment Length:300 Identity:63/300 - (21%)
Similarity:105/300 - (35%) Gaps:88/300 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLS--PYITGHSPMHLAADVEALMSH-- 108
            :|::|....|...|.::..:|:| ...:||.:|....|.|  |....:|....|:.||||::|  
Zfish    81 LVLLHGFPTSSYDWYKIWDSLTQ-RFNRVIALDFLGFGFSDKPRPHRYSIFEQASVVEALVAHLG 144

  Fly   109 ---QRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITPAPVPSNFYLTRQVFEMMLQVAPS 170
               ||:|   .|.|..|.    |:||   :|:.|            |:...:..:          
Zfish   145 LSEQRIN---ILSHDYGD----TVAL---ELLYR------------SDHNRSGHI---------- 177

  Fly   171 IPSNLSLSEGRTFILP------LFQDVVHDASELRRIIYNLRKMQ------DNTFGWAVNP--QA 221
            |.::|.||.|..|  |      ..|.|:.|:..:..::..|...|      ...||....|  ..
Zfish   178 IVNSLCLSNGGIF--PETHHPRFLQKVLKDSGFISPVLTRLMNFQLFSRGIKEVFGPYTQPTEAE 240

  Fly   222 VLSSWG-----------EMMINY--------EATLGGLRPYMGEVLLIAG------SQSEFVTTT 261
            |...|.           :.::.|        |..:|.|...:..:.:|.|      ...:|    
Zfish   241 VWDMWTGIRFNDGNLVMDSLLQYINQRLKHRERWVGALTSTLTPLHMIYGPLDPVNPHPQF---- 301

  Fly   262 SIAVMQRYFPNTVVQILD--AGHCVYEDQPEQFVELVVEF 299
             :.:.|:....:.|.:||  ..|....:.|..|....:.|
Zfish   302 -LQLYQKLVQRSTVSVLDEHVSHYPQLEDPTGFFNAYLSF 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 62/298 (21%)
Abhydrolase_5 47..>165 CDD:289465 31/123 (25%)
Abhydrolase <249..301 CDD:304388 10/58 (17%)
mestNP_571118.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1268438at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.