DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and SPAC22H12.03

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001342787.1 Gene:SPAC22H12.03 / 2541745 PomBaseID:SPAC22H12.03 Length:270 Species:Schizosaccharomyces pombe


Alignment Length:276 Identity:74/276 - (26%)
Similarity:139/276 - (50%) Gaps:21/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RLEYVSYTSPRNQMQAPPIVVMHDLNLSLESWRQVAVNLSQVGLRQVITVDARNHGLSPYITGHS 94
            :|.:..|::  ...:.||:::.|.|..|..:||.:|...|....|.:..:|.|.||.||.:...|
pombe     7 KLAFEKYSA--TVAKHPPVLIFHGLLGSKRNWRSLAKKFSCKLDRDIYAIDQRCHGDSPCVAPLS 69

  Fly    95 PMHLAADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVDITP--APVPSNFYLT 157
            ...:|.|....|...:|:|...:||.||.:..|..||..|..||::::||.:|  ..:|.::   
pombe    70 YSAMALDAFQFMKDHKLDKASIIGHSMGAKTAMVTALKWPDKVEKLVVVDNSPWYQDLPRDY--- 131

  Fly   158 RQVFEMMLQVAPSIPSNLS-LSEGRTFILPLFQDVVHDASELRR-IIYNLRK--MQDNTFGWAVN 218
            ...|..|:|:.   .:|:: .||....:..:.:|::     :|. ::.||:|  ...|||.:.| 
pombe   132 GAYFRKMIQID---EANITKYSEADKMMSTVEKDIL-----VRSFLLSNLKKDSNNSNTFKFRV- 187

  Fly   219 PQAVLSSWGEMMINYEATLGGLRPYMGEVLLIAGSQSEFVTTTSIAVMQRYFPNTVVQILDAGHC 283
            |..::|...:.:..:.|:|..| .|....|:|...::.|:..:::.|.:::||...:..||.||.
pombe   188 PIELISKSLKTIEGFPASLNDL-VYDSPTLVIRALKAPFIPDSALPVFKKFFPKYELVSLDCGHW 251

  Fly   284 VYEDQPEQFVELVVEF 299
            |:.::|::|.|.::.|
pombe   252 VHFEKPKEFSESIINF 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 73/274 (27%)
Abhydrolase_5 47..>165 CDD:289465 36/119 (30%)
Abhydrolase <249..301 CDD:304388 14/51 (27%)
SPAC22H12.03NP_001342787.1 PRK10673 13..269 CDD:331147 73/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2382
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62887
OrthoFinder 1 1.000 - - FOG0001908
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1622
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.