DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14717 and lid-1

DIOPT Version :9

Sequence 1:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001348662.1 Gene:lid-1 / 172888 WormBaseID:WBGene00007711 Length:365 Species:Caenorhabditis elegans


Alignment Length:279 Identity:67/279 - (24%)
Similarity:92/279 - (32%) Gaps:85/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ARNHGL---SPYITGHSPMHLAAD---------VEALMSHQR---LNKIVALGHGMGGRAMMTLA 130
            |:||.:   .|...|.|.....:|         ||.:...::   :.|:..:||..||......|
 Worm    95 AKNHAVHSFDPLGFGRSSRSRFSDDNAIAELEMVEVMEDWRKAMGIEKMYIIGHAFGGYLASAYA 159

  Fly   131 LTQPQLVERVILVDITPAPVPSNF---YLTRQVFEMMLQV------------------------- 167
            |..|..|..:||||      |..|   ..|.:.....||:                         
 Worm   160 LENPSRVAHLILVD------PWGFAEKVETTEKLNTWLQIKPYAWMSFLGGVAGYFNPFSPMRWM 218

  Fly   168 ---APSIPSNLSLSEGRTFILPLFQDVVHDASELRRIIY-NLRKMQDNT--------FGWAVNPQ 220
               ||:|...|     |..:|..|.. :||....:.:.| ||......|        .|||..| 
 Worm   219 GPYAPAIVKKL-----RPDLLLRFPG-LHDYDIYKYVYYLNLPNPTGETAFMNMTLPVGWAKRP- 276

  Fly   221 AVLSSWGEMMINYEATLGGLRPYMGEVLLIAGSQSEFVTTTSIAVMQRYFPNTVVQI---LDAGH 282
                     ||.   ...|:...:| |..|.||:|......:|.: |....|..|.|   ..||.
 Worm   277 ---------MIK---RFNGIDKNVG-VSFIYGSKSWIDPGPAIDI-QSTRENAYVDIKIVRGAGT 327

  Fly   283 CVYEDQPEQFVELVVEFTQ 301
            .||.|.|..|.|:|.:..:
 Worm   328 HVYADDPAAFNEIVSDVVE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 67/275 (24%)
Abhydrolase_5 47..>165 CDD:289465 25/101 (25%)
Abhydrolase <249..301 CDD:304388 18/54 (33%)
lid-1NP_001348662.1 PLN02894 <58..360 CDD:215484 67/279 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR42886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.