DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and HAND1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_004812.1 Gene:HAND1 / 9421 HGNCID:4807 Length:215 Species:Homo sapiens


Alignment Length:202 Identity:51/202 - (25%)
Similarity:79/202 - (39%) Gaps:54/202 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HPHPIDQPTYMPDVPFQPLWG------QEAP--------PPPIVPYQELIAGFPCTDLSLWQRSQ 53
            ||||...   |...||  |:|      ||.|        |....|  :..||.|           
Human    15 HPHPAHP---MLHEPF--LFGPASRCHQERPYFQSWLLSPADAAP--DFPAGGP----------- 61

  Fly    54 VTPLVPQRPSTNGRANGSSSSSKKTRRRVASMA-----QRRAANIRERRRMFNLNEAFDKLRRKV 113
                 |...:....|.|..:...::..|:.::.     ::.:...:||||..::|.||.:||..:
Human    62 -----PPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECI 121

  Fly   114 PTFAYEKRLSRIETLRLAITYIGFMAELL-----SGTPSNSHKSRSDVYGSMNG-------HHQA 166
            |....:.:||:|:|||||.:||.::.::|     ||.|...........|....       .|:.
Human   122 PNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEG 186

  Fly   167 PPPAIHP 173
            .|||:.|
Human   187 FPPALGP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 18/47 (38%)
HAND1NP_004812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 12/73 (16%)
bHLH_TS_HAND1 94..153 CDD:381522 21/58 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..198 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.