DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and ATOH8

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_011531441.1 Gene:ATOH8 / 84913 HGNCID:24126 Length:328 Species:Homo sapiens


Alignment Length:173 Identity:47/173 - (27%)
Similarity:72/173 - (41%) Gaps:42/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PIDQPTYMPDV-----PFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQRPST- 64
            |..:|...|.:     |.:|  ...|||.|..|                ..|.|.|..|.||.. 
Human   144 PFREPGLRPRILLCAPPARP--APSAPPAPPAP----------------PESTVRPAPPTRPGES 190

  Fly    65 ----------NGRANGSSSSSKKTRRRVASMAQRRA--------ANIRERRRMFNLNEAFDKLRR 111
                      |...:.|:|..|:.....|:.::.:|        ||.|||.|:..::.||:.||:
Human   191 SYSSISHVIYNNHQDSSASPRKRPGEATAASSEIKALQQTRRLLANARERTRVHTISAAFEALRK 255

  Fly   112 KVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNSHKSRS 154
            :||.::|.::||::..||:|..||..:|.|.....|..|.:.|
Human   256 QVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNLS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 19/55 (35%)
ATOH8XP_011531441.1 HLH 231..282 CDD:278439 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.