DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and neurod6

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001072273.1 Gene:neurod6 / 779726 XenbaseID:XB-GENE-969227 Length:337 Species:Xenopus tropicalis


Alignment Length:146 Identity:42/146 - (28%)
Similarity:67/146 - (45%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KKTRRRVASMAQRRA-ANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMA 139
            |.|:.|:..:..||. ||.|||.||..||:|.|.||:.||.::..::||:|||||||..||..::
 Frog    83 KMTKVRIERIKVRRVEANARERGRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALS 147

  Fly   140 ELLS------------------GTPS----------NSHKSRSDVYGSMNGHHQAPPPAIHPHHL 176
            |:|.                  ..|:          |:........|....|.::|..:::|.:.
 Frog   148 EILRIGKRPDLLTFVQSLCKGLSQPTTNLVAGCLQLNARSFLMSQSGDTMHHTRSPYTSVYPPYH 212

  Fly   177 HPAAAYQRDFASPYNH 192
            .|      :.::|.:|
 Frog   213 SP------ELSTPPSH 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 26/48 (54%)
neurod6NP_001072273.1 bHLH_TS_NeuroD4_ATOH3 74..151 CDD:381564 32/67 (48%)
Neuro_bHLH 153..272 CDD:372170 9/76 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.