DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and BHLHA9

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001157877.1 Gene:BHLHA9 / 727857 HGNCID:35126 Length:235 Species:Homo sapiens


Alignment Length:162 Identity:52/162 - (32%)
Similarity:73/162 - (45%) Gaps:39/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GFPCTDLSLWQRSQVTPLVPQRPSTNG--RANGSSSS--------SKKTRRRVASMAQRRAANIR 94
            |.||               |:....:|  .|||:|.|        .::..|.|.|.|:|.|||:|
Human    24 GGPC---------------PEPGGDSGVLGANGASCSRGEAEEPAGRRRARPVRSKARRMAANVR 73

  Fly    95 ERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPS----------NS 149
            ||:|:.:.||||:.|||.:......||||:|.|||.||..|..::.:|..:|:          :.
Human    74 ERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG 138

  Fly   150 HKSRSDVYGSMNGHHQAPPPAIHPHHLHPAAA 181
            ..:|.|. |....   :|||...|....|.||
Human   139 PAARGDT-GDTGA---SPPPPAGPSLARPDAA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 25/47 (53%)
BHLHA9NP_001157877.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 15/59 (25%)
HLH 66..117 CDD:278439 26/50 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..235 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5396
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.