DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Atoh8

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_722473.1 Gene:Atoh8 / 71093 MGIID:1918343 Length:322 Species:Mus musculus


Alignment Length:158 Identity:46/158 - (29%)
Similarity:67/158 - (42%) Gaps:38/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PFQPLWGQEAP-PPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQRPST-----------NGRAN 69
            |.:|.  |.|| .||..|                |.|.|.|..|.||..           |...:
Mouse   160 PARPT--QSAPLAPPAAP----------------QESPVRPAPPTRPGESSYSSISHVIYNNHPD 206

  Fly    70 GSSSSSKK--------TRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIE 126
            .|:|..|:        |..:.....:|..||.|||.|:..::.||:.||::||.::|.::||::.
Mouse   207 SSASPRKRPGEATAASTEIKALQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLA 271

  Fly   127 TLRLAITYIGFMAELLSGTPSNSHKSRS 154
            .||:|..||..:|.|.....|..|.:.|
Mouse   272 ILRIACNYILSLARLADLDYSADHSNLS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 19/47 (40%)
Atoh8NP_722473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..96
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..144
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..221 19/78 (24%)
Basic motif, degenerate. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 231..244 6/12 (50%)
HLH 232..283 CDD:278439 21/50 (42%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 245..283 14/37 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.