DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and SCX

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001073983.1 Gene:SCX / 642658 HGNCID:32322 Length:201 Species:Homo sapiens


Alignment Length:157 Identity:47/157 - (29%)
Similarity:64/157 - (40%) Gaps:51/157 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QVTPLVPQRPSTNGRANGSSSSSKK-------------TRRRVASM---------------AQRR 89
            :|:||    .....|.:.||.|.:|             .|||....               .||.
Human    18 EVSPL----SEDEDRGSDSSGSDEKPCRVHAARCGLQGARRRAGGRRAGGGGPGGRPGREPRQRH 78

  Fly    90 AANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELL-------SGTPS 147
            .||.|||.|..::|.||..||..:||...:::||:|||||||.:||..:..:|       .|.|.
Human    79 TANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLGNVLLAGEACGDGQPC 143

  Fly   148 NS-----HKSRSDVYGSMNGHHQAPPP 169
            :|     |.:|:       |....|||
Human   144 HSGPAFFHAARA-------GSPPPPPP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 24/47 (51%)
SCXNP_001073983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 19/77 (25%)
bHLH_TS_scleraxis 73..140 CDD:381521 27/66 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..177 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.