DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Ascl1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_071779.1 Gene:Ascl1 / 64186 RGDID:71010 Length:233 Species:Rattus norvegicus


Alignment Length:169 Identity:47/169 - (27%)
Similarity:75/169 - (44%) Gaps:42/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QRSQVTPLVPQRPSTNG---------RANGSSSSSKKTRRRV------ASMAQRRAA-----NIR 94
            |..|::|:...:||..|         |...||....:.:||:      .|:.|::.|     |.|
  Rat    59 QAPQLSPVADGQPSGGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNER 123

  Fly    95 ERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNSHKSRSDVYGS 159
            ||.|:..:|..|..||..||..|..|::|::||||.|:.||..:.:||            |.:.:
  Rat   124 ERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLL------------DEHDA 176

  Fly   160 MNGHHQAP--PPAIHPHHLH--------PAAAYQRDFAS 188
            ::...||.  .|.|.|::.:        |.::|..|..|
  Rat   177 VSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 21/52 (40%)
Ascl1NP_071779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..95 9/35 (26%)
HLH 131..173 CDD:197674 18/53 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.