DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and mespba

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_571627.1 Gene:mespba / 58070 ZFINID:ZDB-GENE-000406-9 Length:236 Species:Danio rerio


Alignment Length:178 Identity:48/178 - (26%)
Similarity:68/178 - (38%) Gaps:56/178 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDQP-TYMPDVPFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQRPSTNGRANG 70
            |..| |..||..|       :||....|        ||:.|                     ...
Zfish    21 ISSPETTSPDQSF-------SPPHQTKP--------PCSKL---------------------VKS 49

  Fly    71 SSSSSKKTRRRVASMAQRRA-ANIRERRRMFNLNEAFDKLRRKVPTFA--YEKRLSRIETLRLAI 132
            |:...||.|.|:.:.::||. |:.:|:.||.:|.:|...||..:|...  ..:.|::||||||.|
Zfish    50 SNIMRKKRRLRLKNPSERRQNASEKEKLRMRDLTKALHHLRSFLPASVAPVGQTLTKIETLRLTI 114

  Fly   133 TYIGFMAELL---------------SGTPSNSHKSRSDVYGSMNGHHQ 165
            .||.|::..|               ||...:|.:. |.|.|...|..|
Zfish   115 QYISFLSSQLGLSEEELSYRRQENSSGCSLSSFEC-SSVNGGFVGTEQ 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 19/50 (38%)
mespbaNP_571627.1 HLH 67..120 CDD:278439 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.