DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and Atoh1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001102708.1 Gene:Atoh1 / 500156 RGDID:1565171 Length:351 Species:Rattus norvegicus


Alignment Length:247 Identity:71/247 - (28%)
Similarity:99/247 - (40%) Gaps:90/247 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HPHPIDQPTYMPDVPFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLV--------- 58
            |.||  ||.::|.:..||....:|...|:.|.:  ::....||...|    :||.:         
  Rat    20 HRHP--QPHHIPQLTPQPPATLQARDHPVYPAE--LSLLDSTDPRAW----LTPTLQGLCTARAA 76

  Fly    59 ------PQRPSTNG--------------RANGSSSSSKK------------------------TR 79
                  |:..::..              |.:|....||.                        :|
  Rat    77 QYLLHSPELGASEAAAPGDEADGQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSR 141

  Fly    80 RRVASMAQ--------RRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIG 136
            :|..|..|        |.|||.||||||..||.|||:||..:|:|..:|:||:.|||::|..||.
  Rat   142 QRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYIN 206

  Fly   137 FMAELLSGTPSNSHKSRSDVYGSMNGHHQAPPPAI-----HPHHLHPAAAYQ 183
            .::|||. |||..              .|.||||.     | |||..||:|:
  Rat   207 ALSELLQ-TPSVG--------------EQPPPPAASCKNDH-HHLRAAASYE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 27/55 (49%)
Atoh1NP_001102708.1 HLH 155..213 CDD:238036 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.