DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and NEUROG1

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_006152.2 Gene:NEUROG1 / 4762 HGNCID:7764 Length:237 Species:Homo sapiens


Alignment Length:120 Identity:43/120 - (35%)
Similarity:56/120 - (46%) Gaps:25/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PQRPSTNGRANGSSSSS-------------KKTRRRVASMA--------QRRAANIRERRRMFNL 102
            |..|:..|..|.|.:|.             ::.|.||.|.|        :|..||.|||.||.||
Human    44 PPAPARRGAPNISRASEVPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNL 108

  Fly   103 NEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELL----SGTPSNSHKSR 153
            |.|.|.||..:|:|..:.:|::|||||.|..||..:||.|    .|.|....:.|
Human   109 NAALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARER 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 24/47 (51%)
NEUROG1NP_006152.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..83 9/38 (24%)
HLH 90..149 CDD:238036 28/58 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.