DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and amos

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:99 Identity:44/99 - (44%)
Similarity:58/99 - (58%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 WQRSQ----VTPLVPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKL 109
            |.:.|    ...|.....|:...|:.|||||......|.. .:|.|||.||||||.:||:|||||
  Fly    98 WNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLK-KRRLAANARERRRMNSLNDAFDKL 161

  Fly   110 RRKVPTFAYEKRLSRIETLRLAITYIGFMAELLS 143
            |..||:..:::|||:.|||::|..|||.:..|||
  Fly   162 RDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 27/47 (57%)
amosNP_477446.1 HLH 137..195 CDD:238036 31/58 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.