DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer3 and FIGLA

DIOPT Version :9

Sequence 1:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001004311.2 Gene:FIGLA / 344018 HGNCID:24669 Length:219 Species:Homo sapiens


Alignment Length:160 Identity:42/160 - (26%)
Similarity:67/160 - (41%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 APPPPIV--PYQELIAGFPCTDLSLWQRSQVTPLVPQRPSTNGRANGSSSSSKKTRRRVASMAQR 88
            |.||.::  |..|::...        .|.|..|| ||..:........|.....|......:.:|
Human    12 AAPPALLGTPQAEVLEDV--------LREQFGPL-PQLAAVCRLKRLPSGGYSSTENLQLVLERR 67

  Fly    89 RAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNSHKSR 153
            |.||.:||.|:.|||..|.:|:..||.....::.|:::.|:.|..||..:::||.|. .:|.|..
Human    68 RVANAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDLLEGA-KDSKKQD 131

  Fly   154 SDVYGSMNGHHQAPPPAIHPHHLHPAAAYQ 183
            .|.....|...::          |.::|.|
Human   132 PDEQSYSNNSSES----------HTSSARQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer3NP_524322.1 HLH 87..135 CDD:278439 17/47 (36%)
FIGLANP_001004311.2 HLH 65..122 CDD:238036 20/56 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..151 6/37 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.